DRE1D_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DRE1D_ARATH
• UniProt AC: Q9FJ93
• Protein Name: Dehydration-responsive element-binding protein 1D
• Gene Name: DREB1D
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 224
• Subcellular Localization: Nucleus .
• Protein Description: Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'. Binding to the C-repeat/DRE element mediates abscisic acid- and dehydration-inducible transcription. CBF/DREB1 factors play a key role in freezing tolerance and cold acclimation..
• Protein Sequence: MNPFYSTFPDSFLSISDHRSPVSDSSECSPKLASSCPKKRAGRKKFRETRHPIYRGVRQRNSGKWVCEVREPNKKSRIWLGTFPTVEMAARAHDVAALALRGRSACLNFADSAWRLRIPETTCPKEIQKAASEAAMAFQNETTTEGSKTAAEAEEAAGEGVREGERRAEEQNGGVFYMDDEALLGMPNFFENMAEGMLLPPPEVGWNHNDFDGVGDVSLWSFDE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
25	Phosphorylation	HRSPVSDSSECSPKL CCCCCCCCCCCCHHH	22.11	28295753
26	Phosphorylation	RSPVSDSSECSPKLA CCCCCCCCCCCHHHH	47.84	28295753
147	Phosphorylation	NETTTEGSKTAAEAE CCCCCCCCHHHHHHH	22.17	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DRE1D_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DRE1D_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DRE1D_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of DRE1D_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.