UniProt ID | DRE1D_ARATH | |
---|---|---|
UniProt AC | Q9FJ93 | |
Protein Name | Dehydration-responsive element-binding protein 1D | |
Gene Name | DREB1D | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 224 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'. Binding to the C-repeat/DRE element mediates abscisic acid- and dehydration-inducible transcription. CBF/DREB1 factors play a key role in freezing tolerance and cold acclimation.. | |
Protein Sequence | MNPFYSTFPDSFLSISDHRSPVSDSSECSPKLASSCPKKRAGRKKFRETRHPIYRGVRQRNSGKWVCEVREPNKKSRIWLGTFPTVEMAARAHDVAALALRGRSACLNFADSAWRLRIPETTCPKEIQKAASEAAMAFQNETTTEGSKTAAEAEEAAGEGVREGERRAEEQNGGVFYMDDEALLGMPNFFENMAEGMLLPPPEVGWNHNDFDGVGDVSLWSFDE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
25 | Phosphorylation | HRSPVSDSSECSPKL CCCCCCCCCCCCHHH | 22.11 | 28295753 | |
26 | Phosphorylation | RSPVSDSSECSPKLA CCCCCCCCCCCHHHH | 47.84 | 28295753 | |
147 | Phosphorylation | NETTTEGSKTAAEAE CCCCCCCCHHHHHHH | 22.17 | 24894044 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DRE1D_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DRE1D_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DRE1D_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DRE1D_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...