UniProt ID | DPOLB_MOUSE | |
---|---|---|
UniProt AC | Q8K409 | |
Protein Name | DNA polymerase beta | |
Gene Name | Polb | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 335 | |
Subcellular Localization | Nucleus. Cytoplasm. Cytoplasmic in normal conditions. Translocates to the nucleus following DNA damage (By similarity).. | |
Protein Description | Repair polymerase that plays a key role in base-excision repair. Has 5'-deoxyribose-5-phosphate lyase (dRP lyase) activity that removes the 5' sugar phosphate and also acts as a DNA polymerase that adds one nucleotide to the 3' end of the arising single-nucleotide gap. Conducts 'gap-filling' DNA synthesis in a stepwise distributive fashion rather than in a processive fashion as for other DNA polymerases (By similarity).. | |
Protein Sequence | MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVTGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLNEIKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPNFTSESSKQPKLLHRVVEQLQKVHFITDTLSKGETKFMGVCQLPSEKDGKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEQDIFDYIQWRYREPKDRSE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
72 | Acetylation | VGTKIAEKIDEFLAT CCHHHHHHHHHHHHH | 46.57 | 23806337 | |
81 | Acetylation | DEFLATGKLRKLEKI HHHHHHCHHHHHHHH | 40.54 | 23806337 | |
83 | Methylation | FLATGKLRKLEKIRQ HHHHCHHHHHHHHHC | 45.02 | - | |
104 | Phosphorylation | INFLTRVTGIGPSAA HHHHHHHHCCCHHHH | 21.57 | 28066266 | |
109 | Phosphorylation | RVTGIGPSAARKFVD HHHCCCHHHHHHHHH | 29.37 | 28066266 | |
152 | Methylation | DFEKRIPREEMLQMQ HHHHHCCHHHHHHHH | 50.57 | - | |
204 | Phosphorylation | HPNFTSESSKQPKLL CCCCCCCCCCCCHHH | 42.47 | - | |
205 | Phosphorylation | PNFTSESSKQPKLLH CCCCCCCCCCCHHHH | 31.12 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DPOLB_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
41 | K | ubiquitylation |
| - |
61 | K | ubiquitylation |
| - |
81 | K | ubiquitylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DPOLB_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DPOLB_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...