dbPTM

DPB3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DPB3_SCHPO
UniProt AC	Q10315
Protein Name	DNA polymerase epsilon subunit C
Gene Name	dpb3
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	199
Subcellular Localization	Nucleus .
Protein Description	DNA polymerase II participates in chromosomal DNA replication. Essential for cell cycle progression..
Protein Sequence	MGDPTNNNDSETKPNPATYWKSRFPVARIKKIMQADQDVGKVAQVTPVIMSKALELFMQSIIQESCKQTRLHQAKRVTVSHLKHAVQSVEQFDFLQDIVEKVPDAPPIKAERKTKRPRARRAANEGEHNESVPAKKVKKNTVKEEEIEKDDESATTETPVKEEPTGEETEADHEEKASVDHGNFSDKTTSEASSASGDE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of DPB3_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DPB3_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DPB3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DPB3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DPB2_SCHPO	dpb2	physical	15388803
DPB4_SCHPO	dpb4	physical	15388803
NC2B_SCHPO	SPBC30D10.02	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DPB3_SCHPO

Related Literatures of Post-Translational Modification