UniProt ID | DOXA1_HUMAN | |
---|---|---|
UniProt AC | Q1HG43 | |
Protein Name | Dual oxidase maturation factor 1 | |
Gene Name | DUOXA1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 343 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | May be required for the maturation and the transport from the endoplasmic reticulum to the plasma membrane of functional DUOX1.. | |
Protein Sequence | MATLGHTFPFYAGPKPTFPMDTTLASIIMIFLTALATFIVILPGIRGKTRLFWLLRVVTSLFIGAAILAVNFSSEWSVGQVSTNTSYKAFSSEWISADIGLQVGLGGVNITLTGTPVQQLNETINYNEEFTWRLGENYAEEYAKALEKGLPDPVLYLAEKFTPRSPCGLYRQYRLAGHYTSAMLWVAFLCWLLANVMLSMPVLVYGGYMLLATGIFQLLALLFFSMATSLTSPCPLHLGASVLHTHHGPAFWITLTTGLLCVLLGLAMAVAHRMQPHRLKAFFNQSVDEDPMLEWSPEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYCKEAHPKDPDCAL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
84 | N-linked_Glycosylation | SVGQVSTNTSYKAFS CCCEEECCCCCCEEC | 21.37 | UniProtKB CARBOHYD | |
109 | N-linked_Glycosylation | QVGLGGVNITLTGTP CEECCCEEEEEECCC | 25.46 | UniProtKB CARBOHYD | |
121 | N-linked_Glycosylation | GTPVQQLNETINYNE CCCHHHHHHHCCCCH | 39.77 | UniProtKB CARBOHYD | |
286 | Phosphorylation | LKAFFNQSVDEDPML HHHHHCCCCCCCCCC | 32.42 | 20639409 | |
304 | Phosphorylation | PEEGGLLSPRYRSMA CCCCCCCCHHHHHHC | 16.63 | 24719451 | |
307 | Phosphorylation | GGLLSPRYRSMADSP CCCCCHHHHHHCCCC | 15.49 | 23090842 | |
309 | Phosphorylation | LLSPRYRSMADSPKS CCCHHHHHHCCCCCC | 14.91 | 20639409 | |
313 | Phosphorylation | RYRSMADSPKSQDIP HHHHHCCCCCCCCCC | 25.37 | 20639409 | |
316 | Phosphorylation | SMADSPKSQDIPLSE HHCCCCCCCCCCCCH | 36.15 | 25056879 | |
322 | Phosphorylation | KSQDIPLSEASSTKA CCCCCCCCHHHHCHH | 26.26 | 20639409 | |
325 | Phosphorylation | DIPLSEASSTKAYCK CCCCCHHHHCHHHHH | 34.19 | 20639409 | |
326 | Phosphorylation | IPLSEASSTKAYCKE CCCCHHHHCHHHHHH | 40.76 | 20639409 | |
327 | Phosphorylation | PLSEASSTKAYCKEA CCCHHHHCHHHHHHH | 19.73 | 20639409 | |
448 (in isoform 2) | Phosphorylation | - | 27794612 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DOXA1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DOXA1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DOXA1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DOXA1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...