UniProt ID | DOPD_HUMAN | |
---|---|---|
UniProt AC | P30046 | |
Protein Name | D-dopachrome decarboxylase | |
Gene Name | DDT | |
Organism | Homo sapiens (Human). | |
Sequence Length | 118 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI).. | |
Protein Sequence | MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MPFLELDTN ------CCCEECCCC | 42.40 | - | |
8 | Phosphorylation | MPFLELDTNLPANRV CCCEECCCCCCCCCC | 51.81 | - | |
14 | Methylation | DTNLPANRVPAGLEK CCCCCCCCCCCHHHH | 37.59 | - | |
21 | Acetylation | RVPAGLEKRLCAAAA CCCCHHHHHHHHHHH | 56.57 | 23749302 | |
21 | Ubiquitination | RVPAGLEKRLCAAAA CCCCHHHHHHHHHHH | 56.57 | 21890473 | |
21 | Ubiquitination | RVPAGLEKRLCAAAA CCCCHHHHHHHHHHH | 56.57 | 21890473 | |
24 | S-nitrosocysteine | AGLEKRLCAAAASIL CHHHHHHHHHHHHHH | 2.55 | - | |
24 | S-nitrosylation | AGLEKRLCAAAASIL CHHHHHHHHHHHHHH | 2.55 | 19483679 | |
29 | Phosphorylation | RLCAAAASILGKPAD HHHHHHHHHHCCCCC | 17.39 | 24972180 | |
33 | Malonylation | AAASILGKPADRVNV HHHHHHCCCCCCCCE | 33.32 | 26320211 | |
33 | Ubiquitination | AAASILGKPADRVNV HHHHHHCCCCCCCCE | 33.32 | - | |
33 | Acetylation | AAASILGKPADRVNV HHHHHHCCCCCCCCE | 33.32 | 26051181 | |
76 | Phosphorylation | GTAEDNRSHSAHFFE EEECCCCCCHHHHHH | 28.22 | 25693802 | |
78 | Phosphorylation | AEDNRSHSAHFFEFL ECCCCCCHHHHHHHH | 25.37 | 25693802 | |
87 | Ubiquitination | HFFEFLTKELALGQD HHHHHHHHHHHCCCC | 53.53 | - | |
95 | Methylation | ELALGQDRILIRFFP HHHCCCCEEEEEECC | 20.09 | - | |
105 | Phosphorylation | IRFFPLESWQIGKIG EEECCCCCCCCCCCE | 31.78 | 21712546 | |
110 | Methylation | LESWQIGKIGTVMTF CCCCCCCCCEEEEEC | 39.32 | 23644510 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DOPD_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DOPD_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DOPD_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DOPD_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...