UniProt ID | DNJC9_MOUSE | |
---|---|---|
UniProt AC | Q91WN1 | |
Protein Name | DnaJ homolog subfamily C member 9 | |
Gene Name | Dnajc9 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 259 | |
Subcellular Localization | Nucleus . Cytoplasm . Cell membrane . Predominantly nuclear. Translocates to the cytoplasm and membrane after heat shock. | |
Protein Description | May play a role as co-chaperone of the Hsp70 family proteins HSPA1A, HSPA1B and HSPA8.. | |
Protein Sequence | MGLLELCEQVFGTADLYQVLGVRREASDGEVRRGYHKVSLQVHPDRVEEDQKEDATRRFQILGRVYAVLSDKEQKAVYDEQGTVDEDSAGLNQDRDWDAYWRLLFKKISLEDIQAFEKTYKGSEEELNDIKQAYLDFKGDMDQIMESVLCVQYTDEPRIRNIIQKAIESKEIPAYSAFVKESKQKMNARKRRAQEEAKEAELSRKELGLEEGVDNLKALIQSRQKDRQKEMDSFLAQMEAKYCKPSKGGKRTALKKEKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
109 | Phosphorylation | RLLFKKISLEDIQAF HHHHHHCCHHHHHHH | 34.29 | 25521595 | |
165 | Acetylation | RIRNIIQKAIESKEI HHHHHHHHHHHCCCC | 40.71 | 22826441 | |
217 | Ubiquitination | EEGVDNLKALIQSRQ HHHHHHHHHHHHHHH | 47.61 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DNJC9_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DNJC9_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DNJC9_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DNJC9_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...