| UniProt ID | DNJC9_MOUSE | |
|---|---|---|
| UniProt AC | Q91WN1 | |
| Protein Name | DnaJ homolog subfamily C member 9 | |
| Gene Name | Dnajc9 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 259 | |
| Subcellular Localization | Nucleus . Cytoplasm . Cell membrane . Predominantly nuclear. Translocates to the cytoplasm and membrane after heat shock. | |
| Protein Description | May play a role as co-chaperone of the Hsp70 family proteins HSPA1A, HSPA1B and HSPA8.. | |
| Protein Sequence | MGLLELCEQVFGTADLYQVLGVRREASDGEVRRGYHKVSLQVHPDRVEEDQKEDATRRFQILGRVYAVLSDKEQKAVYDEQGTVDEDSAGLNQDRDWDAYWRLLFKKISLEDIQAFEKTYKGSEEELNDIKQAYLDFKGDMDQIMESVLCVQYTDEPRIRNIIQKAIESKEIPAYSAFVKESKQKMNARKRRAQEEAKEAELSRKELGLEEGVDNLKALIQSRQKDRQKEMDSFLAQMEAKYCKPSKGGKRTALKKEKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 109 | Phosphorylation | RLLFKKISLEDIQAF HHHHHHCCHHHHHHH | 34.29 | 25521595 | |
| 165 | Acetylation | RIRNIIQKAIESKEI HHHHHHHHHHHCCCC | 40.71 | 22826441 | |
| 217 | Ubiquitination | EEGVDNLKALIQSRQ HHHHHHHHHHHHHHH | 47.61 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DNJC9_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DNJC9_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DNJC9_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of DNJC9_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...