UniProt ID | DNJ5B_HUMAN | |
---|---|---|
UniProt AC | Q9UF47 | |
Protein Name | DnaJ homolog subfamily C member 5B | |
Gene Name | DNAJC5B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 199 | |
Subcellular Localization |
Membrane Lipid-anchor . May be associated with the trans-Golgi network. |
|
Protein Description | ||
Protein Sequence | MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEKFKEINNAHAILTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLLTGCYFCCCLCCCCNCCCGHCRPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTNANEKTQLIKEGSRSYCTDS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | IPNQRQRTLSTTGEA CCCHHCHHHHHHHHH | 19.40 | 28450419 | |
14 | Phosphorylation | NQRQRTLSTTGEALY CHHCHHHHHHHHHHH | 24.26 | 28450419 | |
15 | Phosphorylation | QRQRTLSTTGEALYE HHCHHHHHHHHHHHH | 41.77 | 28450419 | |
16 | Phosphorylation | RQRTLSTTGEALYEI HCHHHHHHHHHHHHH | 29.64 | 28450419 | |
31 | Phosphorylation | LGLHKGASNEEIKKT HCCCCCCCHHHHHHH | 54.14 | 30622161 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DNJ5B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DNJ5B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DNJ5B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DNJ5B_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...