DNJ5B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DNJ5B_HUMAN
• UniProt AC: Q9UF47
• Protein Name: DnaJ homolog subfamily C member 5B
• Gene Name: DNAJC5B
• Organism: Homo sapiens (Human).
• Sequence Length: 199
• Subcellular Localization: Membrane ; Lipid-anchor . May be associated with the trans-Golgi network.
• Protein Sequence: MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEKFKEINNAHAILTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLLTGCYFCCCLCCCCNCCCGHCRPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTNANEKTQLIKEGSRSYCTDS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
12	Phosphorylation	IPNQRQRTLSTTGEA CCCHHCHHHHHHHHH	19.40	28450419
14	Phosphorylation	NQRQRTLSTTGEALY CHHCHHHHHHHHHHH	24.26	28450419
15	Phosphorylation	QRQRTLSTTGEALYE HHCHHHHHHHHHHHH	41.77	28450419
16	Phosphorylation	RQRTLSTTGEALYEI HCHHHHHHHHHHHHH	29.64	28450419
31	Phosphorylation	LGLHKGASNEEIKKT HCCCCCCCHHHHHHH	54.14	30622161

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DNJ5B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DNJ5B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DNJ5B_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of DNJ5B_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.