UniProt ID | DNAL1_MOUSE | |
---|---|---|
UniProt AC | Q05A62 | |
Protein Name | Dynein light chain 1, axonemal | |
Gene Name | Dnal1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 190 | |
Subcellular Localization | Cytoplasm, cytoskeleton, cilium axoneme . | |
Protein Description | Part of the multisubunit axonemal ATPase complexes that generate the force for cilia motility and govern beat frequency (By similarity). Component of the outer arm dynein (ODA). May be involved in a mechanosensory feedback mechanism controlling ODA activity based on external conformational cues by tethering the outer arm dynein heavy chain (DNAH5) to the microtubule within the axoneme (By similarity). Important for ciliary function in the airways and for the function of the cilia that produce the nodal flow essential for the determination of the left-right asymmetry (By similarity).. | |
Protein Sequence | MAKATTIKEALSRWEEKTGQKPSDAKEIKLYAQIPPIEKMDASLSTLGNCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGETLEELWISYNFIEKLKGIHVMKKLKILYMSNNLVKDWAEFLKLAELPCLEDLVFVGNPLEEKHSAEGNWIDEATKRVPKLKKLDGTPVIKEDEEEES | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAKATTIKE ------CCCCHHHHH | 15.36 | - | |
3 | Malonylation | -----MAKATTIKEA -----CCCCHHHHHH | 44.99 | 26320211 | |
56 | Phosphorylation | NCEKLSLSTNCIEKI CCCEECCCHHHHHHH | 17.75 | 21082442 | |
57 | Phosphorylation | CEKLSLSTNCIEKIA CCEECCCHHHHHHHH | 39.13 | 26239621 | |
70 | Ubiquitination | IANLNGLKNLRILSL HHCCCCCCCCEEEEE | 56.16 | 22790023 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DNAL1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DNAL1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DNAL1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DNAL1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...