dbPTM

DNAL1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DNAL1_MOUSE
UniProt AC	Q05A62
Protein Name	Dynein light chain 1, axonemal
Gene Name	Dnal1
Organism	Mus musculus (Mouse).
Sequence Length	190
Subcellular Localization	Cytoplasm, cytoskeleton, cilium axoneme .
Protein Description	Part of the multisubunit axonemal ATPase complexes that generate the force for cilia motility and govern beat frequency (By similarity). Component of the outer arm dynein (ODA). May be involved in a mechanosensory feedback mechanism controlling ODA activity based on external conformational cues by tethering the outer arm dynein heavy chain (DNAH5) to the microtubule within the axoneme (By similarity). Important for ciliary function in the airways and for the function of the cilia that produce the nodal flow essential for the determination of the left-right asymmetry (By similarity)..
Protein Sequence	MAKATTIKEALSRWEEKTGQKPSDAKEIKLYAQIPPIEKMDASLSTLGNCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGETLEELWISYNFIEKLKGIHVMKKLKILYMSNNLVKDWAEFLKLAELPCLEDLVFVGNPLEEKHSAEGNWIDEATKRVPKLKKLDGTPVIKEDEEEES

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAKATTIKE ------CCCCHHHHH	15.36	-
3	Malonylation	-----MAKATTIKEA -----CCCCHHHHHH	44.99	26320211
56	Phosphorylation	NCEKLSLSTNCIEKI CCCEECCCHHHHHHH	17.75	21082442
57	Phosphorylation	CEKLSLSTNCIEKIA CCEECCCHHHHHHHH	39.13	26239621
70	Ubiquitination	IANLNGLKNLRILSL HHCCCCCCCCEEEEE	56.16	22790023

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DNAL1_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DNAL1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DNAL1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of DNAL1_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DNAL1_MOUSE

Related Literatures of Post-Translational Modification