UniProt ID | DMRTD_HUMAN | |
---|---|---|
UniProt AC | Q8IXT2 | |
Protein Name | Doublesex- and mab-3-related transcription factor C2 | |
Gene Name | DMRTC2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 367 | |
Subcellular Localization | Nucleus . | |
Protein Description | May be involved in sexual development.. | |
Protein Sequence | MEPSDMPAGYHCPLDSAPWDETRDPQSTELIPRRAISRSPTCARCRNHGVTAHLKGHKRLCLFQACECHKCVLILERRRVMAAQVALRRQQEAQLKKHLMRRGEASPKAPNHFRKGTTQPQVPSGKENIAPQPQTPHGAVLLAPTPPGKNSCGPLLLSHPPEASPLSWTPVPPGPWVPGHWLPPGFSMPPPVVCRLLYQEPAVSLPPFPGFDPGTSLQLPTHGPFTTCPGSHPVLTAPLSGEPQGPPSQPRTHSTLILQPCGTPDPLQLQPQASGASCLARTSGPSEWQLQQEAAEALVGLKDSSQAPRVTPSVPPNPAWISLLHPCGPPAPAGGRGFQPVGPCLRPSPAPSVALHIGRLGSISLLS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
117 | Phosphorylation | PNHFRKGTTQPQVPS CCCCCCCCCCCCCCC | 25.87 | 24114839 | |
118 | Phosphorylation | NHFRKGTTQPQVPSG CCCCCCCCCCCCCCC | 47.09 | 24114839 | |
124 | Phosphorylation | TTQPQVPSGKENIAP CCCCCCCCCCCCCCC | 64.74 | - | |
145 | Phosphorylation | GAVLLAPTPPGKNSC CEEEECCCCCCCCCC | 36.19 | 30266825 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DMRTD_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DMRTD_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DMRTD_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TRXR1_HUMAN | TXNRD1 | physical | 21988832 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...