UniProt ID | DMBX1_HUMAN | |
---|---|---|
UniProt AC | Q8NFW5 | |
Protein Name | Diencephalon/mesencephalon homeobox protein 1 | |
Gene Name | DMBX1 {ECO:0000312|HGNC:HGNC:19026} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 382 | |
Subcellular Localization | Nucleus . | |
Protein Description | Functions as a transcriptional repressor. May repress OTX2-mediated transactivation by forming a heterodimer with OTX2 on the P3C (5'-TAATCCGATTA-3') sequence. Required for brain development (By similarity).. | |
Protein Sequence | MQHYGVNGYSLHAMNSLSAMYNLHQQAAQQAQHAPDYRPSVHALTLAERLAGCTFQDIILEARYGSQHRKQRRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRSLQKEQLQKQKEAEGSHGEGKAEAPTPDTQLDTEQPPRLPGSDPPAELHLSLSEQSASESAPEDQPDREEDPRAGAEDPKAEKSPGADSKGLGCKRGSPKADSPGSLTITPVAPGGGLLGPSHSYSSSPLSLFRLQEQFRQHMAATNNLVHYSSFEVGGPAPAAAAAAAAVPYLGVNMAPLGSLHCQSYYQSLSAAAAAHQGVWGSPLLPAPPAGLAPASATLNSKTTSIENLRLRAKQHAASLGLDTLPN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
45 | O-linked_Glycosylation | RPSVHALTLAERLAG CCHHHHHHHHHHHCC | 25.38 | 30379171 | |
95 | Phosphorylation | KTFQKTHYPDVVMRE HHHHHHCCCCHHHHH | 13.32 | 18669648 | |
142 | Acetylation | KEQLQKQKEAEGSHG HHHHHHHHHHCCCCC | 66.96 | 11925863 | |
221 | Ubiquitination | KSPGADSKGLGCKRG CCCCCCCCCCCCCCC | 59.72 | - | |
229 | Phosphorylation | GLGCKRGSPKADSPG CCCCCCCCCCCCCCC | 27.53 | - | |
262 | Phosphorylation | SYSSSPLSLFRLQEQ CCCCCCHHHHHHHHH | 28.92 | 24719451 | |
360 | Phosphorylation | TLNSKTTSIENLRLR CCCCCCCCHHHHHHH | 32.89 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DMBX1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DMBX1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DMBX1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DMBX1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...