UniProt ID | DMAC2_HUMAN | |
---|---|---|
UniProt AC | Q9NW81 | |
Protein Name | Distal membrane-arm assembly complex protein 2 {ECO:0000305} | |
Gene Name | DMAC2 {ECO:0000312|HGNC:HGNC:25496} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 257 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | Required for the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Involved in the assembly of the distal region of complex I.. | |
Protein Sequence | MAAPWASLRLVAPMWNGRIRGIHRLGAAVAPEGNQKKKRTILQFLTNYFYDVEALRDYLLQREMYKVHEKNRSYTWLEKQHGPYGAGAFFILKQGGAVKFRDKEWIRPDKYGHFSQEFWNFCEVPVEAVDAGDCDINYEGLDNLLRLKELQSLSLQRCCHVDDWCLSRLYPLADSLQELSLAGCPRISERGLACLHHLQNLRRLDISDLPAVSNPGLTQILVEEMLPNCEVVGVDWAEGLKSGPEEQPRDTASPVPA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MAAPWASLRLVAPM -CCCCCHHHEEEECC | 24043423 | ||
58 | Phosphorylation | DVEALRDYLLQREMY CHHHHHHHHHHHHHH | - | ||
65 | Phosphorylation | YLLQREMYKVHEKNR HHHHHHHHHHHHHHH | - | ||
74 | Phosphorylation | VHEKNRSYTWLEKQH HHHHHHCCCHHHHHC | - | ||
84 | Phosphorylation | LEKQHGPYGAGAFFI HHHHCCCCCCCEEEE | - | ||
103 | Acetylation | GAVKFRDKEWIRPDK CEEEECCCCCCCCCC | 20167786 | ||
152 | Phosphorylation | LRLKELQSLSLQRCC HHHHHHHHCCCHHHC | 24114839 | ||
154 | Phosphorylation | LKELQSLSLQRCCHV HHHHHHCCCHHHCCC | 24719451 | ||
242 | Phosphorylation | DWAEGLKSGPEEQPR EHHHHHCCCCCCCCC | 23186163 | ||
251 | Phosphorylation | PEEQPRDTASPVPA- CCCCCCCCCCCCCC- | 23403867 | ||
253 | Phosphorylation | EQPRDTASPVPA--- CCCCCCCCCCCC--- | 28355574 | ||
259 | Phosphorylation | ASPVPA--------- CCCCCC--------- | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DMAC2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DMAC2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DMAC2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DMAC2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...