DLX6_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DLX6_HUMAN
• UniProt AC: P56179
• Protein Name: Homeobox protein DLX-6
• Gene Name: DLX6
• Organism: Homo sapiens (Human).
• Sequence Length: 175
• Subcellular Localization: Nucleus .
• Protein Sequence: MSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
9	Phosphorylation	SHSQHSPYLQSYHNS CCCCCCHHHHHHCCC	22.01	24043423
12	Phosphorylation	QHSPYLQSYHNSSAA CCCHHHHHHCCCCHH	26.26	24043423
13	Phosphorylation	HSPYLQSYHNSSAAA CCHHHHHHCCCCHHH	7.64	24043423
16	Phosphorylation	YLQSYHNSSAAAQTR HHHHHCCCCHHHHHC	14.19	24043423
17	Phosphorylation	LQSYHNSSAAAQTRG HHHHCCCCHHHHHCC	27.52	24043423
22	Phosphorylation	NSSAAAQTRGDDTDQ CCCHHHHHCCCCCCC	31.71	24043423
32	Phosphorylation	DDTDQQKTTVIENGE CCCCCCCEEEEECCE	23.20	25690035
33	Phosphorylation	DTDQQKTTVIENGEI CCCCCCEEEEECCEE	26.90	25690035
57	Phosphorylation	RKPRTIYSSLQLQAL CCCCCHHHHHHHHHH	22.26	24719451
85	Phosphorylation	ERAELAASLGLTQTQ HHHHHHHHCCCCHHH	19.84	22964224
91	Phosphorylation	ASLGLTQTQVKIWFQ HHCCCCHHHHHHHHC	30.05	22964224
94 (in isoform 2)	Phosphorylation	-	25.13	17525332
117	Phosphorylation	QGSNPHESDPLQGSA CCCCCCCCCCCCCCC	41.30	29449344
122 (in isoform 3)	Phosphorylation	-	27.25	17525332
122	Phosphorylation	HESDPLQGSAALSPR CCCCCCCCCCCCCCC	27.25	17525332
123	Phosphorylation	ESDPLQGSAALSPRS CCCCCCCCCCCCCCC	9.45	29255136
127	Phosphorylation	LQGSAALSPRSPALP CCCCCCCCCCCCCCC	17.34	29255136
130	Phosphorylation	SAALSPRSPALPPVW CCCCCCCCCCCCCCE	20.22	28387310
241	Phosphorylation	------------------------------------------------------------------------- -------------------------------------------------------------------------		27251275
248	Phosphorylation	-------------------------------------------------------------------------------- --------------------------------------------------------------------------------		27251275

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DLX6_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DLX6_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DLX6_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of DLX6_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.