dbPTM

DLX1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DLX1_HUMAN
UniProt AC	P56177
Protein Name	Homeobox protein DLX-1
Gene Name	DLX1
Organism	Homo sapiens (Human).
Sequence Length	255
Subcellular Localization	Nucleus .
Protein Description	Plays a role as a transcriptional activator or repressor. [PubMed: 14671321 Inhibits several cytokine signaling pathways, such as TGFB1, activin-A/INHBA and BMP4 by interfering with the transcriptional stimulatory activity of transcription factors, such as MSX2, FAST2, SMAD2 and SMAD3 during hematopoietic cell differentiation]
Protein Sequence	MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQLM

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTMTTMPES ------CCCCCCCHH	24.19	-
9	Phosphorylation	TMTTMPESLNSPVSG CCCCCCHHHCCCCCC	27.29	26307563
12	Phosphorylation	TMPESLNSPVSGKAV CCCHHHCCCCCCCEE	31.78	25002506
15	Phosphorylation	ESLNSPVSGKAVFME HHHCCCCCCCEEEEC	37.65	26307563
108	Phosphorylation	LEDPGADSEKSTVVE HCCCCCCCCCCEEEE	46.52	29255136
136	Phosphorylation	RKPRTIYSSLQLQAL CCCCCHHHHHHHHHH	22.26	-
164	Phosphorylation	ERAELAASLGLTQTQ HHHHHHHHCCCCHHH	19.84	22964224
170	Phosphorylation	ASLGLTQTQVKIWFQ HHCCCCHHHHHHHHC	30.05	22964224
206	Phosphorylation	LANGRALSAGSPPVP HHCCCCCCCCCCCCC	29.60	25850435
209	Phosphorylation	GRALSAGSPPVPPGW CCCCCCCCCCCCCCC	26.25	25850435

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DLX1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DLX1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DLX1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of DLX1_HUMAN !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DLX1_HUMAN

Related Literatures of Post-Translational Modification