UniProt ID | DLX1_HUMAN | |
---|---|---|
UniProt AC | P56177 | |
Protein Name | Homeobox protein DLX-1 | |
Gene Name | DLX1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 255 | |
Subcellular Localization | Nucleus . | |
Protein Description | Plays a role as a transcriptional activator or repressor. [PubMed: 14671321 Inhibits several cytokine signaling pathways, such as TGFB1, activin-A/INHBA and BMP4 by interfering with the transcriptional stimulatory activity of transcription factors, such as MSX2, FAST2, SMAD2 and SMAD3 during hematopoietic cell differentiation] | |
Protein Sequence | MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQLM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MTMTTMPES ------CCCCCCCHH | 24.19 | - | |
9 | Phosphorylation | TMTTMPESLNSPVSG CCCCCCHHHCCCCCC | 27.29 | 26307563 | |
12 | Phosphorylation | TMPESLNSPVSGKAV CCCHHHCCCCCCCEE | 31.78 | 25002506 | |
15 | Phosphorylation | ESLNSPVSGKAVFME HHHCCCCCCCEEEEC | 37.65 | 26307563 | |
108 | Phosphorylation | LEDPGADSEKSTVVE HCCCCCCCCCCEEEE | 46.52 | 29255136 | |
136 | Phosphorylation | RKPRTIYSSLQLQAL CCCCCHHHHHHHHHH | 22.26 | - | |
164 | Phosphorylation | ERAELAASLGLTQTQ HHHHHHHHCCCCHHH | 19.84 | 22964224 | |
170 | Phosphorylation | ASLGLTQTQVKIWFQ HHCCCCHHHHHHHHC | 30.05 | 22964224 | |
206 | Phosphorylation | LANGRALSAGSPPVP HHCCCCCCCCCCCCC | 29.60 | 25850435 | |
209 | Phosphorylation | GRALSAGSPPVPPGW CCCCCCCCCCCCCCC | 26.25 | 25850435 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DLX1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DLX1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DLX1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DLX1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...