| UniProt ID | DKK2_HUMAN |  | 
|---|---|---|
| UniProt AC | Q9UBU2 | |
| Protein Name | Dickkopf-related protein 2 | |
| Gene Name | DKK2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 259 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease (By similarity).. | |
| Protein Sequence | MAALMRSKDSSCCLLLLAAVLMVESSQIGSSRAKLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|  | ||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure | ASA (%) | Reference | Orthologous Protein Cluster | 
|---|---|---|---|---|---|
| 52 | N-linked_Glycosylation | ETPGQAANRSAGMYQ CCCCHHHHHHCCCCC | 41.26 | UniProtKB CARBOHYD | |
| 58 | Phosphorylation | ANRSAGMYQGLAFGG HHHHCCCCCHHHCCC | 9.86 | - | |
| 89 | Phosphorylation | KECEVGRYCHSPHQG CCCEECCCCCCCCCC | 6.65 | - | |
| 92 | Phosphorylation | EVGRYCHSPHQGSSA EECCCCCCCCCCCCC | 22.10 | - | |
| 97 | Phosphorylation | CHSPHQGSSACMVCR CCCCCCCCCCHHHCC | 14.27 | - | |
| 98 | Phosphorylation | HSPHQGSSACMVCRR CCCCCCCCCHHHCCC | 32.10 | - | |
| 155 | Phosphorylation | RDRNHGHYSNHDLGW CCCCCCCCCCCCCCC | 18.76 | - | |
| 156 | Phosphorylation | DRNHGHYSNHDLGWQ CCCCCCCCCCCCCCC | 23.24 | - | |
| 173 | Phosphorylation | GRPHTKMSHIKGHEG CCCCCHHHHCCCCCC | 24.50 | 28060719 | |
| 222 | Phosphorylation | TKQRKKGSHGLEIFQ CCCCCCCCCHHHHHH | 24.22 | 26091039 | |
| 250 | Acetylation | KDATYSSKARLHVCQ CCCCCCCCHHEEEEC | 31.42 | 30588189 | 
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources | 
|---|---|---|---|---|---|---|
| Oops, there are no upstream regulatory protein records of DKK2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
| Oops, there are no descriptions of PTM sites of DKK2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) | Residue Change | SAP | Related Disease | Reference | 
|---|---|---|---|---|---|---|
| Oops, there are no SNP-PTM records of DKK2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions | 
|---|---|---|---|---|
| Oops, there are no PPI records of DKK2_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...