UniProt ID | DKK2_HUMAN | |
---|---|---|
UniProt AC | Q9UBU2 | |
Protein Name | Dickkopf-related protein 2 | |
Gene Name | DKK2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 259 | |
Subcellular Localization | Secreted. | |
Protein Description | Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease (By similarity).. | |
Protein Sequence | MAALMRSKDSSCCLLLLAAVLMVESSQIGSSRAKLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
52 | N-linked_Glycosylation | ETPGQAANRSAGMYQ CCCCHHHHHHCCCCC | 41.26 | UniProtKB CARBOHYD | |
58 | Phosphorylation | ANRSAGMYQGLAFGG HHHHCCCCCHHHCCC | 9.86 | - | |
89 | Phosphorylation | KECEVGRYCHSPHQG CCCEECCCCCCCCCC | 6.65 | - | |
92 | Phosphorylation | EVGRYCHSPHQGSSA EECCCCCCCCCCCCC | 22.10 | - | |
97 | Phosphorylation | CHSPHQGSSACMVCR CCCCCCCCCCHHHCC | 14.27 | - | |
98 | Phosphorylation | HSPHQGSSACMVCRR CCCCCCCCCHHHCCC | 32.10 | - | |
155 | Phosphorylation | RDRNHGHYSNHDLGW CCCCCCCCCCCCCCC | 18.76 | - | |
156 | Phosphorylation | DRNHGHYSNHDLGWQ CCCCCCCCCCCCCCC | 23.24 | - | |
173 | Phosphorylation | GRPHTKMSHIKGHEG CCCCCHHHHCCCCCC | 24.50 | 28060719 | |
222 | Phosphorylation | TKQRKKGSHGLEIFQ CCCCCCCCCHHHHHH | 24.22 | 26091039 | |
250 | Acetylation | KDATYSSKARLHVCQ CCCCCCCCHHEEEEC | 31.42 | 30588189 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DKK2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DKK2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DKK2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DKK2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...