UniProt ID | DJC25_MOUSE | |
---|---|---|
UniProt AC | A2ALW5 | |
Protein Name | DnaJ homolog subfamily C member 25 | |
Gene Name | Dnajc25 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 357 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MAARLALRGGPGAAGQRPWLLLAPLLLVPLLARPAEALVEGLYCGTRDCYEVLGVSRSASKAEIARAYRQLARRYHPDRYRPEPGDGPGGAPPSAEAFLLVATAYETLKDEETRKDYDYMLDHPEEYYSHYYHYYSRRLAPKVDVRVVILVSVCAISMFQYFSWWNSYNKAISYLATVPKYRIQATEIAKEQGLLKKAKEKGKNKKSKEEIRDEEENIIKNIIKSKIDIKGGYQKPQVRDLLLFQVILAPVHLCSYIAWYCRWIYNFNIKGKEYGEEERLYIIRKSMKMSQSQFDSLEDHQKEMFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTFVDD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
188 | Ubiquitination | YRIQATEIAKEQGLL HHHHHHHHHHHHCHH | 6.03 | 27667366 | |
290 | Phosphorylation | IRKSMKMSQSQFDSL HHHHHCCCHHHHHCH | 22.59 | 27742792 | |
292 | Phosphorylation | KSMKMSQSQFDSLED HHHCCCHHHHHCHHH | 26.05 | 23984901 | |
307 | Ubiquitination | HQKEMFLKRELWIKE HHHHHHHHHHHHHHH | 32.34 | 27667366 | |
353 | Phosphorylation | NEGPGRLTFVDD--- HCCCCCCEECCC--- | 21.91 | 30352176 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DJC25_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DJC25_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DJC25_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DJC25_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...