| UniProt ID | DJC25_MOUSE | |
|---|---|---|
| UniProt AC | A2ALW5 | |
| Protein Name | DnaJ homolog subfamily C member 25 | |
| Gene Name | Dnajc25 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 357 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MAARLALRGGPGAAGQRPWLLLAPLLLVPLLARPAEALVEGLYCGTRDCYEVLGVSRSASKAEIARAYRQLARRYHPDRYRPEPGDGPGGAPPSAEAFLLVATAYETLKDEETRKDYDYMLDHPEEYYSHYYHYYSRRLAPKVDVRVVILVSVCAISMFQYFSWWNSYNKAISYLATVPKYRIQATEIAKEQGLLKKAKEKGKNKKSKEEIRDEEENIIKNIIKSKIDIKGGYQKPQVRDLLLFQVILAPVHLCSYIAWYCRWIYNFNIKGKEYGEEERLYIIRKSMKMSQSQFDSLEDHQKEMFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTFVDD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 188 | Ubiquitination | YRIQATEIAKEQGLL HHHHHHHHHHHHCHH | 6.03 | 27667366 | |
| 290 | Phosphorylation | IRKSMKMSQSQFDSL HHHHHCCCHHHHHCH | 22.59 | 27742792 | |
| 292 | Phosphorylation | KSMKMSQSQFDSLED HHHCCCHHHHHCHHH | 26.05 | 23984901 | |
| 307 | Ubiquitination | HQKEMFLKRELWIKE HHHHHHHHHHHHHHH | 32.34 | 27667366 | |
| 353 | Phosphorylation | NEGPGRLTFVDD--- HCCCCCCEECCC--- | 21.91 | 30352176 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DJC25_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DJC25_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DJC25_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of DJC25_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...