DJC25_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DJC25_MOUSE
• UniProt AC: A2ALW5
• Protein Name: DnaJ homolog subfamily C member 25
• Gene Name: Dnajc25
• Organism: Mus musculus (Mouse).
• Sequence Length: 357
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MAARLALRGGPGAAGQRPWLLLAPLLLVPLLARPAEALVEGLYCGTRDCYEVLGVSRSASKAEIARAYRQLARRYHPDRYRPEPGDGPGGAPPSAEAFLLVATAYETLKDEETRKDYDYMLDHPEEYYSHYYHYYSRRLAPKVDVRVVILVSVCAISMFQYFSWWNSYNKAISYLATVPKYRIQATEIAKEQGLLKKAKEKGKNKKSKEEIRDEEENIIKNIIKSKIDIKGGYQKPQVRDLLLFQVILAPVHLCSYIAWYCRWIYNFNIKGKEYGEEERLYIIRKSMKMSQSQFDSLEDHQKEMFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTFVDD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
188	Ubiquitination	YRIQATEIAKEQGLL HHHHHHHHHHHHCHH	6.03	27667366
290	Phosphorylation	IRKSMKMSQSQFDSL HHHHHCCCHHHHHCH	22.59	27742792
292	Phosphorylation	KSMKMSQSQFDSLED HHHCCCHHHHHCHHH	26.05	23984901
307	Ubiquitination	HQKEMFLKRELWIKE HHHHHHHHHHHHHHH	32.34	27667366
353	Phosphorylation	NEGPGRLTFVDD--- HCCCCCCEECCC---	21.91	30352176

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DJC25_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DJC25_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DJC25_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of DJC25_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.