UniProt ID | DJC24_HUMAN | |
---|---|---|
UniProt AC | Q6P3W2 | |
Protein Name | DnaJ homolog subfamily C member 24 | |
Gene Name | DNAJC24 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 148 | |
Subcellular Localization | Cytoplasm, cytoskeleton. | |
Protein Description | Stimulates the ATPase activity of several Hsp70-type chaperones. This ability is enhanced by iron-binding. The iron-bound form is redox-active and can function as electron carrier. Plays a role in the diphthamide biosynthesis, a post-translational modification of histidine which occurs in translation elongation factor 2 (EEF2) which can be ADP-ribosylated by diphtheria toxin and by Pseudomonas exotoxin A (Eta).. | |
Protein Sequence | MAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHYN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Ubiquitination | AVEQMPKKDWYSILG CCCCCCCCCHHHHHC | 47.85 | 29967540 | |
10 | Ubiquitination | VEQMPKKDWYSILGA CCCCCCCCHHHHHCC | 56.52 | - | |
12 | Phosphorylation | QMPKKDWYSILGADP CCCCCCHHHHHCCCC | 8.93 | 27642862 | |
27 | Acetylation | SANISDLKQKYQKLI CCCHHHHHHHHHHHH | 50.13 | 11793383 | |
32 | Acetylation | DLKQKYQKLILMYHP HHHHHHHHHHHHHCC | 34.11 | 11793393 | |
147 | Phosphorylation | LIIELLHYN------ HHHHHHCCC------ | 23.65 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DJC24_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DJC24_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DJC24_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DJC24_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...