DIOXL_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DIOXL_ARATH
• UniProt AC: Q949R4
• Protein Name: Extradiol ring-cleavage dioxygenase
• Gene Name: LIGB
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 269
• Protein Description: Opens the cyclic ring of caffealdehyde between carbons 2 and 3 or between carbons 4 and 5. Involved in the biosynthesis of arabidopyrones..
• Protein Sequence: MEKVNQTFFLSHGSPTLSIDDSLEARQFFKSWTQKVLPQKPKSILVISAHWDTKFPSVNTVLRNNTIHDFSGFPDPMYKLKYEAPGAIELGKRVKELLMKEGGMKRVDEDTKRGLDHGAWVPLMLMYPEADIPICQLSVQSNQNGSYHYNMGKALASLKDEGVLIIGSGSATHNLRKLDFNITDGSPVPWALEFDHWLRDSLLQGRYGDVNEWEEKAPNAKMAHPWPEHLYPLHVVMGAAGGDAKAEQIHTSWQLGTLSYSSYSFTSSL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
43	Phosphorylation	VLPQKPKSILVISAH HCCCCCCEEEEEEEE	29.67	28295753
48	Phosphorylation	PKSILVISAHWDTKF CCEEEEEEEECCCCC	13.45	28295753
53	Phosphorylation	VISAHWDTKFPSVNT EEEEECCCCCCCHHH	29.41	28295753

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DIOXL_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DIOXL_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DIOXL_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of DIOXL_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.