UniProt ID | DIC_MOUSE | |
---|---|---|
UniProt AC | Q9QZD8 | |
Protein Name | Mitochondrial dicarboxylate carrier | |
Gene Name | Slc25a10 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 287 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein. |
|
Protein Description | Involved in translocation of malonate, malate and succinate in exchange for phosphate, sulfate, sulfite or thiosulfate across mitochondrial inner membrane.. | |
Protein Sequence | MAEARASRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALQVVRTDGFLALYNGLSASLCRQMTYSLTRFAIYETMRDYMTKDSQGPLPFYNKVLLGGISGLTGGFVGTPADLVNVRMQNDMKLPPSQRRNYSHALDGLYRVAREESLRKLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFVSSFIAGGCATFLCQPLDVLKTRLMNSKGEYQGVFHCAMETAKLGPQAFFKGLFPAGIRLIPHTVLTFMFLEQLRKHFGIKVPTT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
40 | Acetylation | LQTQQEVKLRMTGMA HCCHHHHHHHHHCCC | 29.62 | 23201123 | |
68 | S-palmitoylation | NGLSASLCRQMTYSL CCCCHHHHHHHHHHH | 2.35 | 28526873 | |
101 | Acetylation | GPLPFYNKVLLGGIS CCCCCCCCHHCCCCC | 23.92 | 23954790 | |
141 | Phosphorylation | PSQRRNYSHALDGLY HHHCCCHHHHHHHHH | 13.06 | - | |
158 | Acetylation | AREESLRKLFSGATM HCHHHHHHHHCCCCC | 60.21 | 23576753 | |
158 | Succinylation | AREESLRKLFSGATM HCHHHHHHHHCCCCC | 60.21 | 23806337 | |
253 | Acetylation | LGPQAFFKGLFPAGI CCHHHHHCCCCCCCC | 48.53 | 23576753 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DIC_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DIC_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DIC_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DIC_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...