| UniProt ID | DHR13_MOUSE | |
|---|---|---|
| UniProt AC | Q5SS80 | |
| Protein Name | Dehydrogenase/reductase SDR family member 13 | |
| Gene Name | Dhrs13 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 376 | |
| Subcellular Localization | Secreted . | |
| Protein Description | Putative oxidoreductase.. | |
| Protein Sequence | MEMLLLGAGLLLGAYVLVYYNLVKAPSCGGIGSLRGRTVVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALDLASLASVQAFATAFLSSEPRLDVLIHNAGISSCGRTRETFNLLLRVNHVGPFLLTHLLLPRLRSCAPSRVVIVSSAAHRRGRLDFTRLDCPVVGWQQELRAYADSKLANVLFARELATQLEGTGVTCYAAHPGPVNSELFLRHLPGWLRPILRPLAWLVLRAPQGGAQTPLYCALQEGIEPLSGRYFANCHVEEVSPAARDDQAAQRLWKATKKLAGLAPGDDDDDPDEEPEPEDPRAPSSQSAPSPEKTTVSGPSHSYQGSQDLSKLTQRRIQVKDEPTP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 38 | Phosphorylation | IGSLRGRTVVVTGAN CCCCCCCEEEEECCC | 22.07 | 28059163 | |
| 52 | Phosphorylation | NSGIGKMTALELARR CCCHHHHHHHHHHHC | 31.41 | 28059163 | |
| 181 | Phosphorylation | RRGRLDFTRLDCPVV HCCCCCCCCCCCCCC | 29.95 | 28059163 | |
| 335 | Phosphorylation | PEDPRAPSSQSAPSP CCCCCCCCCCCCCCC | 39.77 | 28066266 | |
| 336 | Phosphorylation | EDPRAPSSQSAPSPE CCCCCCCCCCCCCCC | 27.39 | 28066266 | |
| 338 | Phosphorylation | PRAPSSQSAPSPEKT CCCCCCCCCCCCCCC | 44.06 | 28066266 | |
| 341 | Phosphorylation | PSSQSAPSPEKTTVS CCCCCCCCCCCCCCC | 45.46 | 28066266 | |
| 348 | Phosphorylation | SPEKTTVSGPSHSYQ CCCCCCCCCCCCCCC | 42.78 | 25619855 | |
| 351 | Phosphorylation | KTTVSGPSHSYQGSQ CCCCCCCCCCCCCCC | 28.70 | 25619855 | |
| 353 | Phosphorylation | TVSGPSHSYQGSQDL CCCCCCCCCCCCCCH | 24.40 | 25619855 | |
| 354 | Phosphorylation | VSGPSHSYQGSQDLS CCCCCCCCCCCCCHH | 16.09 | 25619855 | |
| 357 | Phosphorylation | PSHSYQGSQDLSKLT CCCCCCCCCCHHHHH | 12.66 | 25619855 | |
| 361 | Phosphorylation | YQGSQDLSKLTQRRI CCCCCCHHHHHHHHC | 33.63 | 25619855 | |
| 375 | Phosphorylation | IQVKDEPTP------ CCCCCCCCC------ | 39.31 | 25266776 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DHR13_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DHR13_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DHR13_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of DHR13_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "ATM and ATR substrate analysis reveals extensive protein networksresponsive to DNA damage."; Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III,Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N.,Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J.; Science 316:1160-1166(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-357 AND SER-361, ANDMASS SPECTROMETRY. | |
