UniProt ID | DHI1L_HUMAN | |
---|---|---|
UniProt AC | Q7Z5J1 | |
Protein Name | Hydroxysteroid 11-beta-dehydrogenase 1-like protein | |
Gene Name | HSD11B1L | |
Organism | Homo sapiens (Human). | |
Sequence Length | 315 | |
Subcellular Localization | Secreted . | |
Protein Description | ||
Protein Sequence | MKVLLLTGLGALFFAYYWDDNFDPASLQGARVLLTGANAGVGEELAYHYARLGSHLVLTAHTEALLQKVVGNCRKLGAPKVFYIAADMASPEAPESVVQFALDKLGGLDYLVLNHIGGAPAGTRARSPQATRWLMQVNFVSYVQLTSRALPSLTDSKGSLVVVSSLLGRVPTSFSTPYSAAKFALDGFFGSLRRELDVQDVNVAITMCVLGLRDRASAAEAVRSSTSRPRQPEHRGVPLQSQTAMFLPPTVPGARTLTETPLRGWPQPKMKSSRQKSKTEKNDGHLEPVTAWEVQVPRVRRLCRGLARPHLFGHD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
123 | Phosphorylation | IGGAPAGTRARSPQA CCCCCCCCCCCCHHH | 24.22 | - | |
141 | Phosphorylation | LMQVNFVSYVQLTSR HHHCCCCCHHHHHHC | 18.56 | 23663014 | |
142 | Phosphorylation | MQVNFVSYVQLTSRA HHCCCCCHHHHHHCC | 6.21 | 23663014 | |
146 | Phosphorylation | FVSYVQLTSRALPSL CCCHHHHHHCCCCCC | 10.08 | 23663014 | |
147 | Phosphorylation | VSYVQLTSRALPSLT CCHHHHHHCCCCCCC | 24.93 | 23663014 | |
152 | Phosphorylation | LTSRALPSLTDSKGS HHHCCCCCCCCCCCC | 44.76 | 18491316 | |
154 | Phosphorylation | SRALPSLTDSKGSLV HCCCCCCCCCCCCEE | 42.43 | 21406692 | |
156 | Phosphorylation | ALPSLTDSKGSLVVV CCCCCCCCCCCEEEE | 33.41 | 21406692 | |
159 | Phosphorylation | SLTDSKGSLVVVSSL CCCCCCCCEEEEECC | 23.02 | 21406692 | |
164 | Phosphorylation | KGSLVVVSSLLGRVP CCCEEEEECCCCCCC | 12.03 | 18491316 | |
165 | Phosphorylation | GSLVVVSSLLGRVPT CCEEEEECCCCCCCC | 18.92 | 21406692 | |
172 | Phosphorylation | SLLGRVPTSFSTPYS CCCCCCCCCCCCHHH | 39.28 | 24043423 | |
173 | Phosphorylation | LLGRVPTSFSTPYSA CCCCCCCCCCCHHHH | 15.89 | 24043423 | |
175 | Phosphorylation | GRVPTSFSTPYSAAK CCCCCCCCCHHHHHH | 28.39 | 24043423 | |
176 | Phosphorylation | RVPTSFSTPYSAAKF CCCCCCCCHHHHHHH | 25.00 | 24043423 | |
178 | Phosphorylation | PTSFSTPYSAAKFAL CCCCCCHHHHHHHHH | 15.84 | 19413330 | |
179 | Phosphorylation | TSFSTPYSAAKFALD CCCCCHHHHHHHHHH | 23.97 | 24043423 | |
217 | Phosphorylation | LGLRDRASAAEAVRS HHCCCHHHHHHHHHH | 28.98 | 26471730 | |
243 | Phosphorylation | GVPLQSQTAMFLPPT CCCCCCCCEEECCCC | 25.90 | - | |
260 | Phosphorylation | GARTLTETPLRGWPQ CCCCCCCCCCCCCCC | 23.53 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DHI1L_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DHI1L_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DHI1L_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DHI1L_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...