| UniProt ID | DHI1L_HUMAN | |
|---|---|---|
| UniProt AC | Q7Z5J1 | |
| Protein Name | Hydroxysteroid 11-beta-dehydrogenase 1-like protein | |
| Gene Name | HSD11B1L | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 315 | |
| Subcellular Localization | Secreted . | |
| Protein Description | ||
| Protein Sequence | MKVLLLTGLGALFFAYYWDDNFDPASLQGARVLLTGANAGVGEELAYHYARLGSHLVLTAHTEALLQKVVGNCRKLGAPKVFYIAADMASPEAPESVVQFALDKLGGLDYLVLNHIGGAPAGTRARSPQATRWLMQVNFVSYVQLTSRALPSLTDSKGSLVVVSSLLGRVPTSFSTPYSAAKFALDGFFGSLRRELDVQDVNVAITMCVLGLRDRASAAEAVRSSTSRPRQPEHRGVPLQSQTAMFLPPTVPGARTLTETPLRGWPQPKMKSSRQKSKTEKNDGHLEPVTAWEVQVPRVRRLCRGLARPHLFGHD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 123 | Phosphorylation | IGGAPAGTRARSPQA CCCCCCCCCCCCHHH | 24.22 | - | |
| 141 | Phosphorylation | LMQVNFVSYVQLTSR HHHCCCCCHHHHHHC | 18.56 | 23663014 | |
| 142 | Phosphorylation | MQVNFVSYVQLTSRA HHCCCCCHHHHHHCC | 6.21 | 23663014 | |
| 146 | Phosphorylation | FVSYVQLTSRALPSL CCCHHHHHHCCCCCC | 10.08 | 23663014 | |
| 147 | Phosphorylation | VSYVQLTSRALPSLT CCHHHHHHCCCCCCC | 24.93 | 23663014 | |
| 152 | Phosphorylation | LTSRALPSLTDSKGS HHHCCCCCCCCCCCC | 44.76 | 18491316 | |
| 154 | Phosphorylation | SRALPSLTDSKGSLV HCCCCCCCCCCCCEE | 42.43 | 21406692 | |
| 156 | Phosphorylation | ALPSLTDSKGSLVVV CCCCCCCCCCCEEEE | 33.41 | 21406692 | |
| 159 | Phosphorylation | SLTDSKGSLVVVSSL CCCCCCCCEEEEECC | 23.02 | 21406692 | |
| 164 | Phosphorylation | KGSLVVVSSLLGRVP CCCEEEEECCCCCCC | 12.03 | 18491316 | |
| 165 | Phosphorylation | GSLVVVSSLLGRVPT CCEEEEECCCCCCCC | 18.92 | 21406692 | |
| 172 | Phosphorylation | SLLGRVPTSFSTPYS CCCCCCCCCCCCHHH | 39.28 | 24043423 | |
| 173 | Phosphorylation | LLGRVPTSFSTPYSA CCCCCCCCCCCHHHH | 15.89 | 24043423 | |
| 175 | Phosphorylation | GRVPTSFSTPYSAAK CCCCCCCCCHHHHHH | 28.39 | 24043423 | |
| 176 | Phosphorylation | RVPTSFSTPYSAAKF CCCCCCCCHHHHHHH | 25.00 | 24043423 | |
| 178 | Phosphorylation | PTSFSTPYSAAKFAL CCCCCCHHHHHHHHH | 15.84 | 19413330 | |
| 179 | Phosphorylation | TSFSTPYSAAKFALD CCCCCHHHHHHHHHH | 23.97 | 24043423 | |
| 217 | Phosphorylation | LGLRDRASAAEAVRS HHCCCHHHHHHHHHH | 28.98 | 26471730 | |
| 243 | Phosphorylation | GVPLQSQTAMFLPPT CCCCCCCCEEECCCC | 25.90 | - | |
| 260 | Phosphorylation | GARTLTETPLRGWPQ CCCCCCCCCCCCCCC | 23.53 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DHI1L_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DHI1L_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DHI1L_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of DHI1L_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...