| UniProt ID | DHAR1_ARATH | |
|---|---|---|
| UniProt AC | Q9FWR4 | |
| Protein Name | Glutathione S-transferase DHAR1, mitochondrial | |
| Gene Name | DHAR1 {ECO:0000303|PubMed:12077129} | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 213 | |
| Subcellular Localization |
Mitochondrion . Cytoplasm, cytosol . Peroxisome . Membrane Peripheral membrane protein . Exists both as soluble protein and as membrane protein. |
|
| Protein Description | Displays a dual function. As a soluble protein, exhibits glutathione-dependent thiol transferase and dehydroascorbate (DHA) reductase activities. [PubMed: 12077129 Key component of the ascorbate recycling system. Involved in the redox homeostasis, especially in scavenging of ROS under oxidative stresses, subsequently to biotic or abiotic inducers] | |
| Protein Sequence | MALEICVKAAVGAPDHLGDCPFSQRALLTLEEKSLTYKIHLINLSDKPQWFLDISPQGKVPVLKIDDKWVTDSDVIVGILEEKYPDPPLKTPAEFASVGSNIFGTFGTFLKSKDSNDGSEHALLVELEALENHLKSHDGPFIAGERVSAVDLSLAPKLYHLQVALGHFKSWSVPESFPHVHNYMKTLFSLDSFEKTKTEEKYVISGWAPKVNP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DHAR1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DHAR1_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DHAR1_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| U74C1_ARATH | AT2G31790 | physical | 21798944 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...