dbPTM

DGKA_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DGKA_MOUSE
UniProt AC	O88673
Protein Name	Diacylglycerol kinase alpha
Gene Name	Dgka
Organism	Mus musculus (Mouse).
Sequence Length	730
Subcellular Localization
Protein Description	Upon cell stimulation converts the second messenger diacylglycerol into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity..
Protein Sequence	MAKEKGLISPEDFAQLQKYIEYSTKRVSDVLKVFDDGEMNRFCQGDAIGYLGFEQFMKMYLEMEEVPHHLCWALFWSFHTSQVAAEKTKSKANVICLSDVYCYFTLLEGGRPEDKLEFTFKLYDMDRNGILDSTEVEKIILQMMRVAEYLDWDVSELRPILQEMMREMDQDGSGSVSLDEWVRAGATTVPLLVLLGMDVTMKDDGNHIWRPKRFTRLVYCNLCEQSISLGKQGLSCNFCKYIVHDHCAMKAQPCEVSTYAKSRKDIGVQSHLWVRGGCHSGRCDRCQKKIRTYHSLTGLHCVWCHLEIHDDCLQAVGPECDCGLLRDHILPPCSIYPSVLVSGQECKHKTTDDTSLCTPEAFRIEPVSNTHPLLVFINLKSGGKQGQSVLWKFQYILNPRQVFDLKDGPEPGLRFFKDVPQFRILVCGGDGTVGWVLETIDKANFATVPPVAVLPLGTGNDLARCLRWGRGYEGENLRKILKDIELSKVVYLDRWFLEVIPQQNGEKSDPVPSQIINNYFSIGVDASIAHRFHLMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESVTVEICGKLLDLSDLSLEGIAVLNIPSTHGGSNLWGDTKRPHGDTCEINQALGSAAKIITDPDILKTCVPDMSDKRLEVVGIEGAIEMGQIYTRLKSAGHRLAKCSEITFQTTKTLPMQIDGEPWMQAPCTIKITHKNQMPMLMGPPSNSYNFFGFWS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
22	Phosphorylation	QLQKYIEYSTKRVSD HHHHHHHHHCCCHHH	16.45	22817900
28	Phosphorylation	EYSTKRVSDVLKVFD HHHCCCHHHHHHHCC	26.49	28833060
336	Phosphorylation	ILPPCSIYPSVLVSG CCCCCCCCCEEEECC	3.52	22817900
479	Acetylation	YEGENLRKILKDIEL CCCHHHHHHHHHHHH	56.40	-
572	Phosphorylation	TCKKLEESVTVEICG HHHHHCCCEEEEECC	17.45	28285833
669	Phosphorylation	QIYTRLKSAGHRLAK HHHHHHHHHCCHHHC	44.04	28285833

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DGKA_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DGKA_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DGKA_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of DGKA_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DGKA_MOUSE

Related Literatures of Post-Translational Modification