dbPTM

DF252_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DF252_ARATH
UniProt AC	P82632
Protein Name	Putative defensin-like protein 252
Gene Name	SCRL13
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	95
Subcellular Localization	Secreted.
Protein Description
Protein Sequence	MRCVTSFVVLCILMFLVVNNVKVDVKAQRRKPVCKLTGVLNPGKCPTAIHDASNLCSRKLASPNMTFKRCDCQNTEWRGKDHYQCTCYIKLPCNQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
62	Phosphorylation	LCSRKLASPNMTFKR HHHCCCCCCCCEEEE	27.52	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DF252_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DF252_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DF252_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of DF252_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DF252_ARATH

Related Literatures of Post-Translational Modification