DEST_CHICK - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DEST_CHICK
• UniProt AC: P18359
• Protein Name: Destrin
• Gene Name: DSTN
• Organism: Gallus gallus (Chicken).
• Sequence Length: 165
• Protein Description: Actin-depolymerizing protein. Severs actin filaments (F-actin) and binds to actin monomers (G-actin). Acts in a pH-independent manner..
• Protein Sequence: MASGVQVADEVCRIFYDMKVRKCSTPEEVKKRKKAVIFCLSPDKKCIIVEEGKEILVGDVGVTVTDPFKHFVEMLPEKDCRYALYDASFETKESKKEELMFFLWAPEQAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLVVAFEGSPV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MASGVQVAD ------CCCCCCHHH	18.26	-
3	Phosphorylation	-----MASGVQVADE -----CCCCCCHHHH	37.89	23106611
41	Phosphorylation	KAVIFCLSPDKKCII CEEEEEECCCCCEEE	32.03	21736374

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DEST_CHICK !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DEST_CHICK !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DEST_CHICK !!

Protein-Protein Interaction

Oops, there are no PPI records of DEST_CHICK !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.