| UniProt ID | DESI2_HUMAN | |
|---|---|---|
| UniProt AC | Q9BSY9 | |
| Protein Name | Deubiquitinase DESI2 {ECO:0000305} | |
| Gene Name | DESI2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 194 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Has deubiquitinating activity towards 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. Deubiquitinates 'Lys-48'-linked polyubiquitination of RPS7 leading to its stabilization. [PubMed: 28483520] | |
| Protein Sequence | MGANQLVVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPFLQSCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVASTAAGSRPGRHTKL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 47 | Phosphorylation | FAYGGHPYPFSGIFE ECCCCCCCCCCEEEE | 15.96 | - | |
| 64 (in isoform 2) | Ubiquitination | - | 28.04 | 21890473 | |
| 66 | Phosphorylation | NASELGETFKFKEAV CHHHHCCEEEEEEEE | 30.26 | - | |
| 87 | Ubiquitination | FLEDDIEKIVEELGK CCHHHHHHHHHHHHH | 53.00 | - | |
| 97 | Ubiquitination | EELGKEYKGNAYHLM HHHHHHHCCCHHHHH | 46.94 | 2189047 | |
| 97 (in isoform 1) | Ubiquitination | - | 46.94 | 21890473 | |
| 122 | Ubiquitination | LSEILCGKEIPRWIN HHHHHCCCCCHHHHH | 52.02 | - | |
| 176 | Phosphorylation | EAEDAAASASVASTA HHHHHHHHHHHHHHH | 19.15 | 22468782 | |
| 178 | Phosphorylation | EDAAASASVASTAAG HHHHHHHHHHHHHCC | 18.74 | 22468782 | |
| 186 | Phosphorylation | VASTAAGSRPGRHTK HHHHHCCCCCCCCCC | 30.49 | 22468782 | |
| 193 | Ubiquitination | SRPGRHTKL------ CCCCCCCCC------ | 46.18 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DESI2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DESI2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DESI2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of DESI2_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
