UniProt ID | DESI2_HUMAN | |
---|---|---|
UniProt AC | Q9BSY9 | |
Protein Name | Deubiquitinase DESI2 {ECO:0000305} | |
Gene Name | DESI2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 194 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Has deubiquitinating activity towards 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. Deubiquitinates 'Lys-48'-linked polyubiquitination of RPS7 leading to its stabilization. [PubMed: 28483520] | |
Protein Sequence | MGANQLVVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPFLQSCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVASTAAGSRPGRHTKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
47 | Phosphorylation | FAYGGHPYPFSGIFE ECCCCCCCCCCEEEE | 15.96 | - | |
64 (in isoform 2) | Ubiquitination | - | 28.04 | 21890473 | |
66 | Phosphorylation | NASELGETFKFKEAV CHHHHCCEEEEEEEE | 30.26 | - | |
87 | Ubiquitination | FLEDDIEKIVEELGK CCHHHHHHHHHHHHH | 53.00 | - | |
97 | Ubiquitination | EELGKEYKGNAYHLM HHHHHHHCCCHHHHH | 46.94 | 2189047 | |
97 (in isoform 1) | Ubiquitination | - | 46.94 | 21890473 | |
122 | Ubiquitination | LSEILCGKEIPRWIN HHHHHCCCCCHHHHH | 52.02 | - | |
176 | Phosphorylation | EAEDAAASASVASTA HHHHHHHHHHHHHHH | 19.15 | 22468782 | |
178 | Phosphorylation | EDAAASASVASTAAG HHHHHHHHHHHHHCC | 18.74 | 22468782 | |
186 | Phosphorylation | VASTAAGSRPGRHTK HHHHHCCCCCCCCCC | 30.49 | 22468782 | |
193 | Ubiquitination | SRPGRHTKL------ CCCCCCCCC------ | 46.18 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DESI2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DESI2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DESI2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DESI2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...