| UniProt ID | DEOC_MOUSE | |
|---|---|---|
| UniProt AC | Q91YP3 | |
| Protein Name | Deoxyribose-phosphate aldolase | |
| Gene Name | Dera | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 318 | |
| Subcellular Localization | Cytoplasm . Cytoplasmic granule . Nucleus . Recruited to stress granules but not to processing bodies upon arsenite or clotrimazole treatment or energy deprivation. | |
| Protein Description | Catalyzes a reversible aldol reaction between acetaldehyde and D-glyceraldehyde 3-phosphate to generate 2-deoxy-D-ribose 5-phosphate. Participates in stress granule (SG) assembly. May allow ATP production from extracellular deoxyinosine in conditions of energy deprivation.. | |
| Protein Sequence | MAAHCRGTELDLSWISKVQVNHAAVLRRAQQIQARRSVKKEWQAAWLLKAVTFIDLTTLSGDDTFSNVQRLCYKAKYPIRADLLKALNMDDKGITTAAVCVYPARVCDAVKALKAAGCSIPVASVATGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRTLVLTGQWEALYDEVTQFRKACGEAHLKTILATGELGSLTNVYKASLVAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKVGFKPAGGIRTAKESLAWLSLVKEELGDEWLTPDLFRIGASSLLSDIERQIYHHVTGRYAAYHDLPMS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 85 | Ubiquitination | PIRADLLKALNMDDK CHHHHHHHHCCCCCC | 59.11 | 22790023 | |
| 92 | Ubiquitination | KALNMDDKGITTAAV HHCCCCCCCCCEEEE | 48.20 | 22790023 | |
| 100 | S-palmitoylation | GITTAAVCVYPARVC CCCEEEEEEEHHHHH | 1.76 | 28526873 | |
| 111 | Ubiquitination | ARVCDAVKALKAAGC HHHHHHHHHHHHCCC | 50.12 | 22790023 | |
| 114 | Ubiquitination | CDAVKALKAAGCSIP HHHHHHHHHCCCCCE | 40.84 | 22790023 | |
| 137 | Ubiquitination | PAGQTHLKTRLEEIR CCCCCCHHHHHHHHH | 24.80 | 22790023 | |
| 193 | Phosphorylation | HLKTILATGELGSLT HHHHHHHCCCHHHHC | 27.95 | 29472430 | |
| 198 | Phosphorylation | LATGELGSLTNVYKA HHCCCHHHHCHHHHH | 44.65 | 25195567 | |
| 200 | Phosphorylation | TGELGSLTNVYKASL CCCHHHHCHHHHHHH | 25.08 | 26643407 | |
| 223 | Ubiquitination | FIKTSTGKETVNATF CEECCCCCCCCCCCH | 50.75 | 22790023 | |
| 291 | Phosphorylation | DLFRIGASSLLSDIE HHHHHCHHHHHHHHH | 19.12 | 19060867 | |
| 292 | Phosphorylation | LFRIGASSLLSDIER HHHHCHHHHHHHHHH | 32.56 | 27818261 | |
| 295 | Phosphorylation | IGASSLLSDIERQIY HCHHHHHHHHHHHHH | 41.66 | 23984901 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DEOC_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DEOC_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DEOC_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of DEOC_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
