| UniProt ID | DENR_MOUSE | |
|---|---|---|
| UniProt AC | Q9CQJ6 | |
| Protein Name | Density-regulated protein | |
| Gene Name | Denr | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 198 | |
| Subcellular Localization | ||
| Protein Description | May be involved in the translation of target mRNAs by scanning and recognition of the initiation codon. Involved in translation initiation; promotes recruitment of aminoacetyled initiator tRNA to P site of 40S ribosomes. Can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits (By similarity).. | |
| Protein Sequence | MATDISESSGADCKGDTKNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQETGITEGQGPVGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MATDISESS ------CCCCCHHCC | 17.61 | - | |
| 6 | Phosphorylation | --MATDISESSGADC --CCCCCHHCCCCCC | 33.95 | 24759943 | |
| 8 | Phosphorylation | MATDISESSGADCKG CCCCCHHCCCCCCCC | 27.55 | 29472430 | |
| 9 | Phosphorylation | ATDISESSGADCKGD CCCCHHCCCCCCCCC | 33.67 | 25266776 | |
| 20 | Phosphorylation | CKGDTKNSAKLDADY CCCCCCCCCCCCCCC | 28.47 | - | |
| 37 | S-palmitoylation | RVLYCGVCSLPTEYC EEEEEECCCCCHHHH | 1.78 | 28680068 | |
| 69 | Phosphorylation | PNEFAKLTVENSPKQ CCHHHHEEEECCCCC | 25.68 | 25521595 | |
| 73 | Phosphorylation | AKLTVENSPKQETGI HHEEEECCCCCCCCC | 21.70 | 25521595 | |
| 78 | Phosphorylation | ENSPKQETGITEGQG ECCCCCCCCCCCCCC | 31.24 | 25521595 | |
| 81 | Phosphorylation | PKQETGITEGQGPVG CCCCCCCCCCCCCCC | 35.09 | 24925903 | |
| 189 | Phosphorylation | WPEVDDDSIEDLGEV CCCCCCCCCHHHHCC | 34.57 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DENR_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DENR_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DENR_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of DENR_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
