dbPTM

DEGS1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DEGS1_MOUSE
UniProt AC	O09005
Protein Name	Sphingolipid delta(4)-desaturase DES1
Gene Name	Degs1
Organism	Mus musculus (Mouse).
Sequence Length	323
Subcellular Localization	Mitochondrion . Endoplasmic reticulum membrane Multi-pass membrane protein. Membrane Lipid-anchor .
Protein Description	Has sphingolipid-delta-4-desaturase activity. Converts D-erythro-sphinganine to D-erythro-sphingosine (E-sphing-4-enine)..
Protein Sequence	MGSRVSREEFEWVYTDQPHAARRKEILAKYPEIKSLMKPDHNLIWIVAMMLLVQLASFYLVKDLDWKWVIFWSYVFGSCLNHSMTLAIHEISHNFPFGHHKALWNRWFGMFANLSLGVPYSISFKRYHMDHHRYLGADKIDVDIPTDFEGWFFCTTFRKFVWVILQPLFYAFRPLFINPKPITYLEIINTVIQITFDIIIYYVFGVKSLVYMLAATLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNVPGKNLPMVRKIASEYYDDLPHYNSWIKVLYDFVTDDTISPYSRMKRPPKGNEILE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGSRVSREE ------CCCCCCHHH	24.94	-
14	Phosphorylation	REEFEWVYTDQPHAA HHHCEEEECCCCCHH	12.98	25159016
15	Phosphorylation	EEFEWVYTDQPHAAR HHCEEEECCCCCHHH	20.66	25159016
29	Ubiquitination	RRKEILAKYPEIKSL HHHHHHHHCHHHHHH	58.87	27667366
278	Ubiquitination	KNLPMVRKIASEYYD CCCHHHHHHHHHHHH	31.08	22790023
284	Phosphorylation	RKIASEYYDDLPHYN HHHHHHHHHCCCCCC	10.03	-
302	Phosphorylation	KVLYDFVTDDTISPY HHHHHHHCCCCCCCC	28.31	26745281
305	Phosphorylation	YDFVTDDTISPYSRM HHHHCCCCCCCCCCC	26.60	26745281
307	Phosphorylation	FVTDDTISPYSRMKR HHCCCCCCCCCCCCC	21.63	26745281
310	Phosphorylation	DDTISPYSRMKRPPK CCCCCCCCCCCCCCC	29.32	26745281

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DEGS1_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DEGS1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DEGS1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of DEGS1_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DEGS1_MOUSE

Related Literatures of Post-Translational Modification