DDB2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DDB2_MOUSE
• UniProt AC: Q99J79
• Protein Name: DNA damage-binding protein 2
• Gene Name: Ddb2
• Organism: Mus musculus (Mouse).
• Sequence Length: 432
• Subcellular Localization: Nucleus . Accumulates at sites of DNA damage following UV irradiation.
• Protein Description: Required for DNA repair. Binds to DDB1 to form the UV-damaged DNA-binding protein complex (the UV-DDB complex). The UV-DDB complex may recognize UV-induced DNA damage and recruit proteins of the nucleotide excision repair pathway (the NER pathway) to initiate DNA repair. The UV-DDB complex preferentially binds to cyclobutane pyrimidine dimers (CPD), 6-4 photoproducts (6-4 PP), apurinic sites and short mismatches. Also appears to function as the substrate recognition module for the DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex DDB1-CUL4-ROC1 (also known as CUL4-DDB-ROC1 and CUL4-DDB-RBX1). The DDB1-CUL4-ROC1 complex may ubiquitinate histone H2A, histone H3 and histone H4 at sites of UV-induced DNA damage. The ubiquitination of histones may facilitate their removal from the nucleosome and promote subsequent DNA repair. The DDB1-CUL4-ROC1 complex also ubiquitinates XPC, which may enhance DNA-binding by XPC and promote NER..
• Protein Sequence: MAPKKCPETQKSPDVAVLLRSKSRRGPQELEPEAKKLRVQGPVSSRTCESCCLLAELSSLQIPSRSSSIVRDLYQHKLGKATWSSLQQGLQKSFLHSLASYQVFRKAAPFDRRTTSLAWHPTHPSTLAVGSKGGDIMIWNFGIKDKPIFLKGIGAGGSITGLKFNHLNTNQFFASSMEGTTRLQDFKGNILRVYTSSNSCKVWFCSLDVSAKSRVVVTGDNMGHVILLSTDGKELWNLRMHKKKVAHVALNPCCDWLLATASIDQTVKIWDLRQIKGKDSFLYSLPHRHPVNAACFSPDGARLLTTDQNNEIRVYSASQWDSPLNLISHPHRHFQHLTPIKATWHSRHNLIVVGRYPDPNLKSCVPYELRTIDVFDGSSGKMMCQLYDPGYSGITSLNEFNPMGDTLASTMGYHILIWSQEEDGSQKDHERL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
9	Phosphorylation	APKKCPETQKSPDVA CCCCCCCCCCCCCEE	26.83	26643407
12	Phosphorylation	KCPETQKSPDVAVLL CCCCCCCCCCEEHHH	19.26	28507225
163	Acetylation	GGSITGLKFNHLNTN CCCEECEEECCCCCC	45.52	7614511
280	Phosphorylation	RQIKGKDSFLYSLPH HHHCCCCCCHHCCCC	22.19	24719451
283	Phosphorylation	KGKDSFLYSLPHRHP CCCCCCHHCCCCCCC	13.22	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DDB2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DDB2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DDB2_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of DDB2_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.