UniProt ID | DCVR_ARATH | |
---|---|---|
UniProt AC | Q1H537 | |
Protein Name | Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic | |
Gene Name | DVR | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 417 | |
Subcellular Localization | Plastid, chloroplast . | |
Protein Description | Catalyzes the conversion of divinyl chlorophyllide to monovinyl chlorophyllide. Reduces the 8-vinyl group of the tetrapyrrole to an ethyl group using NADPH as the reductant. The best substrate is (3,8-divinyl)-chlorophyllide a (DV-Chlidea). Very low activity with (3,8-divinyl)-protochlorophyllide a (DV-Pchlidea) and (3,8-divinyl)-magnesium-protoporphyrin IX monomethyl ester (DV-MPE). No activity with (3,8-divinyl)-chlorophyllide b (DV-Chlideb), (3,8-divinyl)-magnesium-protoporphyrin IX (DV-Mg-Proto) and either (3,8-divinyl)-chlorophyll a (DV-Chla) or b (DV-Chlb).. | |
Protein Sequence | MSLCSSFNVFASYSPKPKTIFKDSKFISQFQVKSSPLASTFHTNESSTSLKYKRARLKPISSLDSGISEIATSPSFRNKSPKDINVLVVGSTGYIGRFVVKEMIKRGFNVIAVAREKSGIRGKNDKEETLKQLQGANVCFSDVTELDVLEKSIENLGFGVDVVVSCLASRNGGIKDSWKIDYEATKNSLVAGKKFGAKHFVLLSAICVQKPLLEFQRAKLKFEAELMDLAEQQDSSFTYSIVRPTAFFKSLGGQVEIVKDGKPYVMFGDGKLCACKPISEQDLAAFIADCVLEENKINQVLPIGGPGKALTPLEQGEILFKILGREPKFLKVPIEIMDFVIGVLDSIAKIFPSVGEAAEFGKIGRYYAAESMLILDPETGEYSEEKTPSYGKDTLEDFFAKVIREGMAGQELGEQFF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
371 | Phosphorylation | GRYYAAESMLILDPE CCEEEEEEEEEECCC | 19880383 | ||
379 | Phosphorylation | MLILDPETGEYSEEK EEEECCCCCCCCCCC | 19880383 | ||
382 | Phosphorylation | LDPETGEYSEEKTPS ECCCCCCCCCCCCCC | 19880383 | ||
383 | Phosphorylation | DPETGEYSEEKTPSY CCCCCCCCCCCCCCC | 19880383 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DCVR_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DCVR_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DCVR_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DCVR_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...