dbPTM

DCUP_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DCUP_DROME
UniProt AC	Q9V595
Protein Name	Uroporphyrinogen decarboxylase
Gene Name	Updo
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	356
Subcellular Localization	Cytoplasm.
Protein Description	Catalyzes the decarboxylation of four acetate groups of uroporphyrinogen-III to yield coproporphyrinogen-III..
Protein Sequence	MKDAKPFPVLKNDNLLRAARGEVVDRVPVWVMRQAGRYLPEFQELRKHHDFFTVCRTPELACEVTMQPLRRFDLDASIIFSDILVIPQALGLTVEMHAGVGPVLPQPIVVPEDLKRLTPDGALSRLSYVGDAITMMRHKLEGRVPLIGFTGAPWTLMGYMIEGGGSKTMSKAKAWLNEHPEDSKLFLNLLTDAIVDYLEMQVKAGAQMLQVFESSAEHLSKEQFLQWCVPYLKRIRDELVDRLTKKAIPVVPMTLFAKGAGHSLKEQSELGYDVIGLDWTVDPLEARNLVGPNITLQGNLDPQDMYRDPDELRNLTTEMVHKFGKSRYIANLGHGITPQTPITSMEVLVEAVHKAL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of DCUP_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DCUP_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DCUP_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DCUP_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of DCUP_DROME !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DCUP_DROME

Related Literatures of Post-Translational Modification