DCTP1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DCTP1_MOUSE
• UniProt AC: Q9QY93
• Protein Name: dCTP pyrophosphatase 1 {ECO:0000305}
• Gene Name: Dctpp1 {ECO:0000312|MGI:MGI:1913672}
• Organism: Mus musculus (Mouse).
• Sequence Length: 170
• Subcellular Localization: Cytoplasm, cytosol . Not detected in mitochondrion and nucleus.
• Protein Description: Hydrolyzes deoxynucleoside triphosphates (dNTPs) to the corresponding nucleoside monophosphates. Has a strong preference for dCTP and its analogs including 5-iodo-dCTP and 5-methyl-dCTP for which it may even have a higher efficiency. May protect DNA or RNA against the incorporation of these genotoxic nucleotide analogs through their catabolism..
• Protein Sequence: MSTAGDGERGTVGQEDSAAARPFRFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHVDLPQAVISKMDTNRQRYPVHLSRGSACKYTDLPRGTISENQAVGAGDPASELRDQAST

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSTAGDGER ------CCCCCCCCC	27.28	-
2	Phosphorylation	------MSTAGDGER ------CCCCCCCCC	27.28	29514104
17	Phosphorylation	GTVGQEDSAAARPFR CCCCCCCCCCCCCCC	21.03	30635358
110	S-palmitoylation	LVALAARCHVDLPQA HHHHHHHCCCCCCHH	2.92	26165157
139	Glutathionylation	HLSRGSACKYTDLPR EECCCCCCCCCCCCC	3.57	24333276
140	Acetylation	LSRGSACKYTDLPRG ECCCCCCCCCCCCCC	51.40	23806337
162	Phosphorylation	VGAGDPASELRDQAS CCCCCCHHHHHHHHC	42.42	28285833
169	Phosphorylation	SELRDQAST------ HHHHHHHCC------	29.08	25293948
170	Phosphorylation	ELRDQAST------- HHHHHHCC-------	45.72	25293948

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DCTP1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DCTP1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DCTP1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of DCTP1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.