dbPTM

DCTN6_BOVIN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DCTN6_BOVIN
UniProt AC	Q148G7
Protein Name	Dynactin subunit 6
Gene Name	DCTN6
Organism	Bos taurus (Bovine).
Sequence Length	190
Subcellular Localization	Cytoplasm, cytoskeleton. Chromosome, centromere, kinetochore.
Protein Description
Protein Sequence	MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAHPDNITPDAEDPEPKPMIIGTNNVFEVGCYCQAMKIGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGGDCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
186	Phosphorylation	KTMKGSSTPVKN--- HHCCCCCCCCCC---	33.52	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
186	T	Phosphorylation	Kinase	CDK1	P48734	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DCTN6_BOVIN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DCTN6_BOVIN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of DCTN6_BOVIN !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DCTN6_BOVIN

Related Literatures of Post-Translational Modification