dbPTM

DCTN2_CHICK - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DCTN2_CHICK
UniProt AC	Q9PTG6
Protein Name	Dynactin subunit 2
Gene Name	DCTN2
Organism	Gallus gallus (Chicken).
Sequence Length	402
Subcellular Localization	Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Membrane Peripheral membrane protein.
Protein Description	Modulates cytoplasmic dynein binding to an organelle, and plays a role in prometaphase chromosome alignment and spindle organization during mitosis. Involved in anchoring microtubules to centrosomes. May play a role in synapse formation during brain development (By similarity)..
Protein Sequence	MADPKYADLPGIARNEPDVYETSDLPEDDQAEFEAELEELTSTSVEHLIINPNAAFEKFKDKRLGTDGVDFSDRISKSRTTGYESGEYEILGEGLGAKETPQQRYQRLQHEVQELIRDVEQIQSAVKESAAEEELTPMALARQLEGLKQQLVSCHLQKLLGPTAAIDFADPEGALAKRLQQQLEVPSVKKAAPAKSPPKAPGPTTDALTFELFWRRPEQDQFSQTAKIAELEKRLAQLEAMVRCEPDSQNPLLVGAEGTSLVETVQILQAKVNILDAAVLDQVEARLQRRPGSKVNEIAKHKAIVQDADTQSKIHQVVYEMMQRWDHMASSLPDVVQRLLTLRDLHEQASRFVQVLVHLDTTQQEVDVVQRLLAEVQKTMKENLAVVEDNFAEVEARIKRLQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of DCTN2_CHICK !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DCTN2_CHICK !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DCTN2_CHICK !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DCTN2_CHICK !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of DCTN2_CHICK !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DCTN2_CHICK

Related Literatures of Post-Translational Modification