dbPTM

DBLOH_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DBLOH_MOUSE
UniProt AC	Q9JIQ3
Protein Name	Diablo homolog, mitochondrial
Gene Name	Diablo
Organism	Mus musculus (Mouse).
Sequence Length	237
Subcellular Localization	Mitochondrion . Released into the cytosol when cells undergo apoptosis.
Protein Description	Promotes apoptosis by activating caspases in the cytochrome c/Apaf-1/caspase-9 pathway. Acts by opposing the inhibitory activity of inhibitor of apoptosis proteins (IAP). Inhibits the activity of BIRC6/bruce by inhibiting its binding to caspases (By similarity)..
Protein Sequence	MAALRSWVTRSVCSLFRYRQRFPVLANSKKRCFSELIKPWHKTVLTGFGMTLCAVPIAQKSEPQSLSNEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLVSLYRQYTSLLGKMNSQEEDEVWQVIIGARVEMTSKQQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKSQVQEVRQLSQKAETKLAEAQTKELHQKAQEVSDEGADQEEEAYLRED

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
124	Phosphorylation	SLLGKMNSQEEDEVW HHHHCCCCCCCHHHH	35.16	25338131
189	Ubiquitination	RNHIQLVKSQVQEVR HHHHHHHHHHHHHHH	43.70	-
205	Acetylation	LSQKAETKLAEAQTK HHHHHHHHHHHHHHH	36.89	23954790
205	Malonylation	LSQKAETKLAEAQTK HHHHHHHHHHHHHHH	36.89	26320211
212	Ubiquitination	KLAEAQTKELHQKAQ HHHHHHHHHHHHHHH	46.31	22790023
212	Ubiquitination	KLAEAQTKELHQKAQ HHHHHHHHHHHHHHH	46.31	22790023
217	Ubiquitination	QTKELHQKAQEVSDE HHHHHHHHHHHHCCC	41.09	22790023
217	Ubiquitination	QTKELHQKAQEVSDE HHHHHHHHHHHHCCC	41.09	22790023
222	Phosphorylation	HQKAQEVSDEGADQE HHHHHHHCCCCCCHH	29.23	26525534

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DBLOH_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DBLOH_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DBLOH_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
XIAP_MOUSE	Xiap	physical	15207275

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DBLOH_MOUSE

Related Literatures of Post-Translational Modification