UniProt ID | DBLOH_MOUSE | |
---|---|---|
UniProt AC | Q9JIQ3 | |
Protein Name | Diablo homolog, mitochondrial | |
Gene Name | Diablo | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 237 | |
Subcellular Localization | Mitochondrion . Released into the cytosol when cells undergo apoptosis. | |
Protein Description | Promotes apoptosis by activating caspases in the cytochrome c/Apaf-1/caspase-9 pathway. Acts by opposing the inhibitory activity of inhibitor of apoptosis proteins (IAP). Inhibits the activity of BIRC6/bruce by inhibiting its binding to caspases (By similarity).. | |
Protein Sequence | MAALRSWVTRSVCSLFRYRQRFPVLANSKKRCFSELIKPWHKTVLTGFGMTLCAVPIAQKSEPQSLSNEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLVSLYRQYTSLLGKMNSQEEDEVWQVIIGARVEMTSKQQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKSQVQEVRQLSQKAETKLAEAQTKELHQKAQEVSDEGADQEEEAYLRED | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
124 | Phosphorylation | SLLGKMNSQEEDEVW HHHHCCCCCCCHHHH | 35.16 | 25338131 | |
189 | Ubiquitination | RNHIQLVKSQVQEVR HHHHHHHHHHHHHHH | 43.70 | - | |
205 | Acetylation | LSQKAETKLAEAQTK HHHHHHHHHHHHHHH | 36.89 | 23954790 | |
205 | Malonylation | LSQKAETKLAEAQTK HHHHHHHHHHHHHHH | 36.89 | 26320211 | |
212 | Ubiquitination | KLAEAQTKELHQKAQ HHHHHHHHHHHHHHH | 46.31 | 22790023 | |
212 | Ubiquitination | KLAEAQTKELHQKAQ HHHHHHHHHHHHHHH | 46.31 | 22790023 | |
217 | Ubiquitination | QTKELHQKAQEVSDE HHHHHHHHHHHHCCC | 41.09 | 22790023 | |
217 | Ubiquitination | QTKELHQKAQEVSDE HHHHHHHHHHHHCCC | 41.09 | 22790023 | |
222 | Phosphorylation | HQKAQEVSDEGADQE HHHHHHHCCCCCCHH | 29.23 | 26525534 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DBLOH_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DBLOH_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DBLOH_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
XIAP_MOUSE | Xiap | physical | 15207275 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...