UniProt ID | DAW1_HUMAN | |
---|---|---|
UniProt AC | Q8N136 | |
Protein Name | Dynein assembly factor with WDR repeat domains 1 | |
Gene Name | DAW1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 415 | |
Subcellular Localization | Cell projection, cilium . | |
Protein Description | May play a role in axonemal outer row dynein assembly.. | |
Protein Sequence | MKLKSLLLRYYPPGIMLEYEKHGELKTKSIDLLDLGPSTDVSALVEEIQKAEPLLTASRTEQVKLLIQRLQEKLGQNSNHTFYLFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDTASGEELNTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFNTSGDRIITGSFDHTVVVWDADTGRKVNILIGHCAEISSASFNWDCSLILTGSMDKTCKLWDATNGKCVATLTGHDDEILDSCFDYTGKLIATASADGTARIFSAATRKCIAKLEGHEGEISKISFNPQGNHLLTGSSDKTARIWDAQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNTCRIWR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Phosphorylation | LKSLLLRYYPPGIML CHHHHHHHCCCCEEE | 22817900 | ||
19 | Phosphorylation | PPGIMLEYEKHGELK CCCEEEEEEECCCCC | 22817900 | ||
78 | Phosphorylation | QEKLGQNSNHTFYLF HHHHCCCCCCCCHHH | 27067055 | ||
81 | Phosphorylation | LGQNSNHTFYLFKVL HCCCCCCCCHHHHHH | 27067055 | ||
83 | Phosphorylation | QNSNHTFYLFKVLKA CCCCCCCHHHHHHHH | 27067055 | ||
103 | Phosphorylation | TNVALNKSGSCFITG CCEEECCCCCEEEEC | - | ||
105 | Phosphorylation | VALNKSGSCFITGSY EEECCCCCEEEECCC | - | ||
214 | Phosphorylation | QNGEEVYTLRGHSAE CCCCEEEEEECCCEE | 24719451 | ||
404 | Phosphorylation | YKGNIVITGSKDNTC CCCCEEEECCCCCCE | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DAW1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DAW1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DAW1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DAW1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...