UniProt ID | D42E1_HUMAN | |
---|---|---|
UniProt AC | Q8WUS8 | |
Protein Name | Short-chain dehydrogenase/reductase family 42E member 1 {ECO:0000303|PubMed:19027726} | |
Gene Name | SDR42E1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 393 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MDPKRSQKESVLITGGSGYFGFRLGCALNQNGVHVILFDISSPAQTIPEGIKFIQGDIRHLSDVEKAFQDADVTCVFHIASYGMSGREQLNRNLIKEVNVRGTDNILQVCQRRRVPRLVYTSTFNVIFGGQVIRNGDESLPYLPLHLHPDHYSRTKSIAEQKVLEANATPLDRGDGVLRTCALRPAGIYGPGEQRHLPRIVSYIEKGLFKFVYGDPRSLVEFVHVDNLVQAHILASEALRADKGHIASGQPYFISDGRPVNNFEFFRPLVEGLGYTFPSTRLPLTLVYCFAFLTEMVHFILGRLYNFQPFLTRTEVYKTGVTHYFSLEKAKKELGYKAQPFDLQEAVEWFKAHGHGRSSGSRDSECFVWDGLLVFLLIIAVLMWLPSSVILSL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MDPKRSQKESVLI --CCCCHHCCCEEEE | 52.29 | 27134283 | |
10 | Phosphorylation | PKRSQKESVLITGGS CCHHCCCEEEEECCC | 29.29 | 27134283 | |
14 | Phosphorylation | QKESVLITGGSGYFG CCCEEEEECCCCCHH | 31.18 | 27134283 | |
85 | Phosphorylation | HIASYGMSGREQLNR EHHHCCCCHHHHHHH | 30.27 | - | |
93 | Ubiquitination | GREQLNRNLIKEVNV HHHHHHHHHHHHHCC | 45.07 | 22817900 | |
96 | Ubiquitination | QLNRNLIKEVNVRGT HHHHHHHHHHCCCCC | 59.79 | 21906983 | |
139 | Phosphorylation | VIRNGDESLPYLPLH EEECCCCCCCCCCCC | 39.11 | - | |
153 | Ubiquitination | HLHPDHYSRTKSIAE CCCCCCCCCCHHHHH | 30.01 | 27667366 | |
155 | Phosphorylation | HPDHYSRTKSIAEQK CCCCCCCCHHHHHHH | 24.17 | - | |
156 | Ubiquitination | PDHYSRTKSIAEQKV CCCCCCCHHHHHHHH | 38.46 | 27667366 | |
159 | Ubiquitination | YSRTKSIAEQKVLEA CCCCHHHHHHHHHHH | 21.91 | 22817900 | |
162 | Ubiquitination | TKSIAEQKVLEANAT CHHHHHHHHHHHCCC | 40.05 | 21906983 | |
202 | Phosphorylation | RHLPRIVSYIEKGLF CCHHHHHHHHHHCCC | 20.30 | - | |
203 | Phosphorylation | HLPRIVSYIEKGLFK CHHHHHHHHHHCCCH | 11.38 | - | |
315 | Ubiquitination | QPFLTRTEVYKTGVT CCCEEEEEHHHCCCC | 40.33 | 22817900 | |
318 | Ubiquitination | LTRTEVYKTGVTHYF EEEEEHHHCCCCEEE | 43.93 | 21906983 | |
322 | Phosphorylation | EVYKTGVTHYFSLEK EHHHCCCCEEEEHHH | 16.53 | 27135362 | |
326 | Phosphorylation | TGVTHYFSLEKAKKE CCCCEEEEHHHHHHH | 28.58 | 27135362 | |
328 | Ubiquitination | VTHYFSLEKAKKELG CCEEEEHHHHHHHHC | 50.17 | 23503661 | |
329 | Ubiquitination | THYFSLEKAKKELGY CEEEEHHHHHHHHCC | 71.45 | 22817900 | |
331 | Ubiquitination | YFSLEKAKKELGYKA EEEHHHHHHHHCCCC | 58.82 | 23503661 | |
332 | Ubiquitination | FSLEKAKKELGYKAQ EEHHHHHHHHCCCCC | 64.13 | 22817900 | |
334 | Ubiquitination | LEKAKKELGYKAQPF HHHHHHHHCCCCCCC | 14.43 | 22817900 | |
337 | Ubiquitination | AKKELGYKAQPFDLQ HHHHHCCCCCCCCHH | 38.45 | 21906983 | |
348 | Ubiquitination | FDLQEAVEWFKAHGH CCHHHHHHHHHHCCC | 55.00 | 23503661 | |
351 | Ubiquitination | QEAVEWFKAHGHGRS HHHHHHHHHCCCCCC | 40.31 | 23503661 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of D42E1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of D42E1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of D42E1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of D42E1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...