| UniProt ID | D42E1_HUMAN | |
|---|---|---|
| UniProt AC | Q8WUS8 | |
| Protein Name | Short-chain dehydrogenase/reductase family 42E member 1 {ECO:0000303|PubMed:19027726} | |
| Gene Name | SDR42E1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 393 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MDPKRSQKESVLITGGSGYFGFRLGCALNQNGVHVILFDISSPAQTIPEGIKFIQGDIRHLSDVEKAFQDADVTCVFHIASYGMSGREQLNRNLIKEVNVRGTDNILQVCQRRRVPRLVYTSTFNVIFGGQVIRNGDESLPYLPLHLHPDHYSRTKSIAEQKVLEANATPLDRGDGVLRTCALRPAGIYGPGEQRHLPRIVSYIEKGLFKFVYGDPRSLVEFVHVDNLVQAHILASEALRADKGHIASGQPYFISDGRPVNNFEFFRPLVEGLGYTFPSTRLPLTLVYCFAFLTEMVHFILGRLYNFQPFLTRTEVYKTGVTHYFSLEKAKKELGYKAQPFDLQEAVEWFKAHGHGRSSGSRDSECFVWDGLLVFLLIIAVLMWLPSSVILSL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Phosphorylation | --MDPKRSQKESVLI --CCCCHHCCCEEEE | 52.29 | 27134283 | |
| 10 | Phosphorylation | PKRSQKESVLITGGS CCHHCCCEEEEECCC | 29.29 | 27134283 | |
| 14 | Phosphorylation | QKESVLITGGSGYFG CCCEEEEECCCCCHH | 31.18 | 27134283 | |
| 85 | Phosphorylation | HIASYGMSGREQLNR EHHHCCCCHHHHHHH | 30.27 | - | |
| 93 | Ubiquitination | GREQLNRNLIKEVNV HHHHHHHHHHHHHCC | 45.07 | 22817900 | |
| 96 | Ubiquitination | QLNRNLIKEVNVRGT HHHHHHHHHHCCCCC | 59.79 | 21906983 | |
| 139 | Phosphorylation | VIRNGDESLPYLPLH EEECCCCCCCCCCCC | 39.11 | - | |
| 153 | Ubiquitination | HLHPDHYSRTKSIAE CCCCCCCCCCHHHHH | 30.01 | 27667366 | |
| 155 | Phosphorylation | HPDHYSRTKSIAEQK CCCCCCCCHHHHHHH | 24.17 | - | |
| 156 | Ubiquitination | PDHYSRTKSIAEQKV CCCCCCCHHHHHHHH | 38.46 | 27667366 | |
| 159 | Ubiquitination | YSRTKSIAEQKVLEA CCCCHHHHHHHHHHH | 21.91 | 22817900 | |
| 162 | Ubiquitination | TKSIAEQKVLEANAT CHHHHHHHHHHHCCC | 40.05 | 21906983 | |
| 202 | Phosphorylation | RHLPRIVSYIEKGLF CCHHHHHHHHHHCCC | 20.30 | - | |
| 203 | Phosphorylation | HLPRIVSYIEKGLFK CHHHHHHHHHHCCCH | 11.38 | - | |
| 315 | Ubiquitination | QPFLTRTEVYKTGVT CCCEEEEEHHHCCCC | 40.33 | 22817900 | |
| 318 | Ubiquitination | LTRTEVYKTGVTHYF EEEEEHHHCCCCEEE | 43.93 | 21906983 | |
| 322 | Phosphorylation | EVYKTGVTHYFSLEK EHHHCCCCEEEEHHH | 16.53 | 27135362 | |
| 326 | Phosphorylation | TGVTHYFSLEKAKKE CCCCEEEEHHHHHHH | 28.58 | 27135362 | |
| 328 | Ubiquitination | VTHYFSLEKAKKELG CCEEEEHHHHHHHHC | 50.17 | 23503661 | |
| 329 | Ubiquitination | THYFSLEKAKKELGY CEEEEHHHHHHHHCC | 71.45 | 22817900 | |
| 331 | Ubiquitination | YFSLEKAKKELGYKA EEEHHHHHHHHCCCC | 58.82 | 23503661 | |
| 332 | Ubiquitination | FSLEKAKKELGYKAQ EEHHHHHHHHCCCCC | 64.13 | 22817900 | |
| 334 | Ubiquitination | LEKAKKELGYKAQPF HHHHHHHHCCCCCCC | 14.43 | 22817900 | |
| 337 | Ubiquitination | AKKELGYKAQPFDLQ HHHHHCCCCCCCCHH | 38.45 | 21906983 | |
| 348 | Ubiquitination | FDLQEAVEWFKAHGH CCHHHHHHHHHHCCC | 55.00 | 23503661 | |
| 351 | Ubiquitination | QEAVEWFKAHGHGRS HHHHHHHHHCCCCCC | 40.31 | 23503661 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of D42E1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of D42E1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of D42E1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of D42E1_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...