UniProt ID | CYSK2_ARATH | |
---|---|---|
UniProt AC | Q9LJA0 | |
Protein Name | Putative inactive cysteine synthase 2 | |
Gene Name | OASA2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 188 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | ||
Protein Sequence | MASVAPKIAKDVTELIGNTPLVYLNKVAKDCVGHVAAKLEMMEPCSSVKDRIGYSMIADAEAKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLVITMPASMSIERRIILLAFGAELILTDPAKGMKGAVAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGSGGKVDGFVSGIGTGGT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
49 | N6-(pyridoxal phosphate)lysine | MEPCSSVKDRIGYSM CCCCCCCHHHHCCEE | - | ||
49 | Other | MEPCSSVKDRIGYSM CCCCCCCHHHHCCEE | - | ||
78 | Phosphorylation | SVLIEPTSGNTGVGL EEEEECCCCCCCCHH | 29654922 | ||
81 | Phosphorylation | IEPTSGNTGVGLAFT EECCCCCCCCHHHHH | 29654922 | ||
88 | Phosphorylation | TGVGLAFTAAAKGYK CCCHHHHHHHCCCCE | 29654922 | ||
163 | Phosphorylation | NPKIHYETTGPEIWK CCCEEEECCCCCCCC | 22092075 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYSK2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYSK2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYSK2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CYSK2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...