| UniProt ID | CYSD1_ARATH | |
|---|---|---|
| UniProt AC | Q9S6Z7 | |
| Protein Name | Bifunctional L-3-cyanoalanine synthase/cysteine synthase D1 | |
| Gene Name | CYSD1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 324 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Acts as a cysteine synthase. The cysteine synthesis reaction is more efficient than the cyanoalanine synthase activity.. | |
| Protein Sequence | MEEDRCSIKDDATQLIGNTPMVYLNNIVDGCVARIAAKLEMMEPCSSVKERIAYGMIKDAEDKGLITPGKSTLIEATSGNTGIGLAFIGAAKGYKVVLTMPSSMSLERKIILLALGAEVHLTDPSKGVQGIIDKAEEICSKNPDSIMLEQFKNPSNPQTHYRTTGPEIWRDSAGEVDILVAGVGTGGTLSGSGRFLKEKNKDFKVYGVEPTESAVISGGKPGTHLIQGIGAGLIPDNLDFNVLDEVIQVTSVEAIETAKLLALKEGLLVGISSGAAAAAAIKVAKRPENAGKLIVVIFPSGGERYLSTSLFESVRHEAENLPIQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 49 | N6-(pyridoxal phosphate)lysine | MEPCSSVKERIAYGM HCCCCCHHHHHHHCC | - | ||
| 49 | Other | MEPCSSVKERIAYGM HCCCCCHHHHHHHCC | - | ||
| 56 | Sulfoxidation | KERIAYGMIKDAEDK HHHHHHCCCCCHHHC | 25693801 | ||
| 190 | Phosphorylation | VGTGGTLSGSGRFLK CCCCCCCCCCCCCCC | 29654922 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYSD1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYSD1_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYSD1_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| DPNPH_ARATH | HL | physical | 21798944 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...