UniProt ID | CYSD1_ARATH | |
---|---|---|
UniProt AC | Q9S6Z7 | |
Protein Name | Bifunctional L-3-cyanoalanine synthase/cysteine synthase D1 | |
Gene Name | CYSD1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 324 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Acts as a cysteine synthase. The cysteine synthesis reaction is more efficient than the cyanoalanine synthase activity.. | |
Protein Sequence | MEEDRCSIKDDATQLIGNTPMVYLNNIVDGCVARIAAKLEMMEPCSSVKERIAYGMIKDAEDKGLITPGKSTLIEATSGNTGIGLAFIGAAKGYKVVLTMPSSMSLERKIILLALGAEVHLTDPSKGVQGIIDKAEEICSKNPDSIMLEQFKNPSNPQTHYRTTGPEIWRDSAGEVDILVAGVGTGGTLSGSGRFLKEKNKDFKVYGVEPTESAVISGGKPGTHLIQGIGAGLIPDNLDFNVLDEVIQVTSVEAIETAKLLALKEGLLVGISSGAAAAAAIKVAKRPENAGKLIVVIFPSGGERYLSTSLFESVRHEAENLPIQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
49 | N6-(pyridoxal phosphate)lysine | MEPCSSVKERIAYGM HCCCCCHHHHHHHCC | - | ||
49 | Other | MEPCSSVKERIAYGM HCCCCCHHHHHHHCC | - | ||
56 | Sulfoxidation | KERIAYGMIKDAEDK HHHHHHCCCCCHHHC | 25693801 | ||
190 | Phosphorylation | VGTGGTLSGSGRFLK CCCCCCCCCCCCCCC | 29654922 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYSD1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYSD1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYSD1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DPNPH_ARATH | HL | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...