CYPH_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CYPH_SCHPO
• UniProt AC: P18253
• Protein Name: Peptidyl-prolyl cis-trans isomerase
• Gene Name: ppi1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 162
• Subcellular Localization: Cytoplasm.
• Protein Description: PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides..
• Protein Sequence: MSNCFFDVIANGQPLGRIVFKLFDDVVPKTAANFRALCTGEKGYGYAGSTFHRVIPQFMLQGGDFTRGNGTGGKSIYGEKFPDENFALKHNKPGLLSMANAGPNTNGSQFFITTVVTPWLDGKHVVFGEVTEGMDVVKKVESLGSNSGATRARIVIDKCGTV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
75	Phosphorylation	GNGTGGKSIYGEKFP CCCCCCCCCCCCCCC	25.07	25720772
142	Phosphorylation	DVVKKVESLGSNSGA HHHHHHHHCCCCCCC	40.81	28889911
145	Phosphorylation	KKVESLGSNSGATRA HHHHHCCCCCCCCCE	32.87	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CYPH_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CYPH_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CYPH_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of CYPH_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.