UniProt ID | CYH2_MOUSE | |
---|---|---|
UniProt AC | P63034 | |
Protein Name | Cytohesin-2 | |
Gene Name | Cyth2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 400 | |
Subcellular Localization |
Cell membrane Peripheral membrane protein . Cytoplasm . Cell projection . Cell projection, growth cone . Cell junction, tight junction . Cell junction, adherens junction . Recruited to the cell membrane through its association with ARL4A, ARL4C and |
|
Protein Description | Acts as a guanine-nucleotide exchange factor (GEF). Promotes guanine-nucleotide exchange on ARF1, ARF3 and ARF6. Activates ARF factors through replacement of GDP with GTP. [PubMed: 18042453 The cell membrane form, in association with ARL4 proteins, recruits ARF6 to the plasma membrane (By similarity Involved in neurite growth] | |
Protein Sequence | MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVEHELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLSVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEDLLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLAGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
41 | Phosphorylation | QRLREELSEAMSEVE HHHHHHHHHHHHHHH | 26.96 | 23984901 | |
45 | Phosphorylation | EELSEAMSEVEGLEA HHHHHHHHHHHCHHC | 45.60 | 23984901 | |
56 | Phosphorylation | GLEANEGSKTLQRNR CHHCCCHHHHHHHHH | 19.11 | 24719451 | |
58 | Phosphorylation | EANEGSKTLQRNRKM HCCCHHHHHHHHHHH | 29.80 | 26824392 | |
150 | Phosphorylation | ALRQFLWSFRLPGEA HHHHHHHHCCCCCHH | 11.57 | 22609160 | |
159 | Ubiquitination | RLPGEAQKIDRMMEA CCCCHHHHHHHHHHH | 54.33 | - | |
276 | Phosphorylation | LAGGRVKTWKRRWFI ECCCCCCEEEEEEEE | 33.10 | 24719451 | |
360 | Phosphorylation | VYRISAPTQEEKDEW EEEEECCCHHHHHHH | 48.61 | 28059163 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYH2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYH2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYH2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CYH2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...