CYH2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CYH2_MOUSE
• UniProt AC: P63034
• Protein Name: Cytohesin-2
• Gene Name: Cyth2
• Organism: Mus musculus (Mouse).
• Sequence Length: 400
• Subcellular Localization: Cell membrane ; Peripheral membrane protein . Cytoplasm . Cell projection . Cell projection, growth cone . Cell junction, tight junction . Cell junction, adherens junction . Recruited to the cell membrane through its association with ARL4A, ARL4C and
• Protein Description: Acts as a guanine-nucleotide exchange factor (GEF). Promotes guanine-nucleotide exchange on ARF1, ARF3 and ARF6. Activates ARF factors through replacement of GDP with GTP. [PubMed: 18042453 The cell membrane form, in association with ARL4 proteins, recruits ARF6 to the plasma membrane (By similarity Involved in neurite growth]
• Protein Sequence: MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVEHELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLSVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEDLLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLAGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
41	Phosphorylation	QRLREELSEAMSEVE HHHHHHHHHHHHHHH	26.96	23984901
45	Phosphorylation	EELSEAMSEVEGLEA HHHHHHHHHHHCHHC	45.60	23984901
56	Phosphorylation	GLEANEGSKTLQRNR CHHCCCHHHHHHHHH	19.11	24719451
58	Phosphorylation	EANEGSKTLQRNRKM HCCCHHHHHHHHHHH	29.80	26824392
150	Phosphorylation	ALRQFLWSFRLPGEA HHHHHHHHCCCCCHH	11.57	22609160
159	Ubiquitination	RLPGEAQKIDRMMEA CCCCHHHHHHHHHHH	54.33	-
276	Phosphorylation	LAGGRVKTWKRRWFI ECCCCCCEEEEEEEE	33.10	24719451
360	Phosphorylation	VYRISAPTQEEKDEW EEEEECCCHHHHHHH	48.61	28059163

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CYH2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CYH2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CYH2_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of CYH2_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.