UniProt ID | CYC_RAT | |
---|---|---|
UniProt AC | P62898 | |
Protein Name | Cytochrome c, somatic | |
Gene Name | Cycs | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 105 | |
Subcellular Localization | Mitochondrion intermembrane space. Loosely associated with the inner membrane. | |
Protein Description | Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.; Plays a role in apoptosis. Suppression of the anti-apoptotic members or activation of the pro-apoptotic members of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases (By similarity).. | |
Protein Sequence | MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MGDVEKGKK ------CCCHHHCCE | 47.90 | 191069 | |
6 | Acetylation | --MGDVEKGKKIFVQ --CCCHHHCCEEEEE | 75.72 | 22902405 | |
8 | Acetylation | MGDVEKGKKIFVQKC CCCHHHCCEEEEEEC | 54.48 | 22902405 | |
9 | Acetylation | GDVEKGKKIFVQKCA CCHHHCCEEEEEECC | 50.47 | 22902405 | |
28 | Acetylation | VEKGGKHKTGPNLHG ECCCCCCCCCCCCCH | 59.67 | 22902405 | |
29 | Phosphorylation | EKGGKHKTGPNLHGL CCCCCCCCCCCCCHH | 58.55 | 23991683 | |
40 | Succinylation | LHGLFGRKTGQAAGF CCHHCCCCCCCCCCC | 58.34 | 26843850 | |
41 | Phosphorylation | HGLFGRKTGQAAGFS CHHCCCCCCCCCCCE | 32.92 | 28689409 | |
48 | Phosphorylation | TGQAAGFSYTDANKN CCCCCCCEEECCCCC | 26.63 | 29779826 | |
49 | Phosphorylation | GQAAGFSYTDANKNK CCCCCCEEECCCCCC | 13.33 | 20586425 | |
50 | Phosphorylation | QAAGFSYTDANKNKG CCCCCEEECCCCCCC | 27.69 | 23991683 | |
56 | Succinylation | YTDANKNKGITWGED EECCCCCCCCCCCHH | 53.98 | - | |
56 | Acetylation | YTDANKNKGITWGED EECCCCCCCCCCCHH | 53.98 | 22902405 | |
56 | Succinylation | YTDANKNKGITWGED EECCCCCCCCCCCHH | 53.98 | - | |
59 | Phosphorylation | ANKNKGITWGEDTLM CCCCCCCCCCHHHHH | 35.77 | 23991683 | |
64 | Phosphorylation | GITWGEDTLMEYLEN CCCCCHHHHHHHHHC | 24.57 | 23991683 | |
68 | Phosphorylation | GEDTLMEYLENPKKY CHHHHHHHHHCHHHC | 12.83 | 23991683 | |
73 | Succinylation | MEYLENPKKYIPGTK HHHHHCHHHCCCCCC | 70.55 | 26843850 | |
73 | Succinylation | MEYLENPKKYIPGTK HHHHHCHHHCCCCCC | 70.55 | - | |
73 | Acetylation | MEYLENPKKYIPGTK HHHHHCHHHCCCCCC | 70.55 | 23923745 | |
74 | Acetylation | EYLENPKKYIPGTKM HHHHCHHHCCCCCCE | 50.06 | 23923753 | |
80 | Acetylation | KKYIPGTKMIFAGIK HHCCCCCCEEEEEEC | 35.59 | 23923765 | |
88 | Acetylation | MIFAGIKKKGERADL EEEEEECCCCCHHHH | 65.18 | 22902405 | |
89 | Acetylation | IFAGIKKKGERADLI EEEEECCCCCHHHHH | 62.09 | 22902405 | |
98 | Phosphorylation | ERADLIAYLKKATNE CHHHHHHHHHHHHCC | 16.44 | 23991683 | |
100 | Acetylation | ADLIAYLKKATNE-- HHHHHHHHHHHCC-- | 27.90 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYC_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYC_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYC_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CYC_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Primary structure of mouse, rat, and guinea pig cytochrome c."; Carlson S.S., Mross G.A., Wilson A.C., Mead R.T., Wolin L.D.,Bowers S.F., Foley N.T., Muijsers A.O., Margoliash E.; Biochemistry 16:1437-1442(1977). Cited for: PROTEIN SEQUENCE OF 2-105, AND ACETYLATION AT GLY-2. |