| UniProt ID | CYC_RAT | |
|---|---|---|
| UniProt AC | P62898 | |
| Protein Name | Cytochrome c, somatic | |
| Gene Name | Cycs | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 105 | |
| Subcellular Localization | Mitochondrion intermembrane space. Loosely associated with the inner membrane. | |
| Protein Description | Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.; Plays a role in apoptosis. Suppression of the anti-apoptotic members or activation of the pro-apoptotic members of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases (By similarity).. | |
| Protein Sequence | MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MGDVEKGKK ------CCCHHHCCE | 47.90 | 191069 | |
| 6 | Acetylation | --MGDVEKGKKIFVQ --CCCHHHCCEEEEE | 75.72 | 22902405 | |
| 8 | Acetylation | MGDVEKGKKIFVQKC CCCHHHCCEEEEEEC | 54.48 | 22902405 | |
| 9 | Acetylation | GDVEKGKKIFVQKCA CCHHHCCEEEEEECC | 50.47 | 22902405 | |
| 28 | Acetylation | VEKGGKHKTGPNLHG ECCCCCCCCCCCCCH | 59.67 | 22902405 | |
| 29 | Phosphorylation | EKGGKHKTGPNLHGL CCCCCCCCCCCCCHH | 58.55 | 23991683 | |
| 40 | Succinylation | LHGLFGRKTGQAAGF CCHHCCCCCCCCCCC | 58.34 | 26843850 | |
| 41 | Phosphorylation | HGLFGRKTGQAAGFS CHHCCCCCCCCCCCE | 32.92 | 28689409 | |
| 48 | Phosphorylation | TGQAAGFSYTDANKN CCCCCCCEEECCCCC | 26.63 | 29779826 | |
| 49 | Phosphorylation | GQAAGFSYTDANKNK CCCCCCEEECCCCCC | 13.33 | 20586425 | |
| 50 | Phosphorylation | QAAGFSYTDANKNKG CCCCCEEECCCCCCC | 27.69 | 23991683 | |
| 56 | Succinylation | YTDANKNKGITWGED EECCCCCCCCCCCHH | 53.98 | - | |
| 56 | Acetylation | YTDANKNKGITWGED EECCCCCCCCCCCHH | 53.98 | 22902405 | |
| 56 | Succinylation | YTDANKNKGITWGED EECCCCCCCCCCCHH | 53.98 | - | |
| 59 | Phosphorylation | ANKNKGITWGEDTLM CCCCCCCCCCHHHHH | 35.77 | 23991683 | |
| 64 | Phosphorylation | GITWGEDTLMEYLEN CCCCCHHHHHHHHHC | 24.57 | 23991683 | |
| 68 | Phosphorylation | GEDTLMEYLENPKKY CHHHHHHHHHCHHHC | 12.83 | 23991683 | |
| 73 | Succinylation | MEYLENPKKYIPGTK HHHHHCHHHCCCCCC | 70.55 | 26843850 | |
| 73 | Succinylation | MEYLENPKKYIPGTK HHHHHCHHHCCCCCC | 70.55 | - | |
| 73 | Acetylation | MEYLENPKKYIPGTK HHHHHCHHHCCCCCC | 70.55 | 23923745 | |
| 74 | Acetylation | EYLENPKKYIPGTKM HHHHCHHHCCCCCCE | 50.06 | 23923753 | |
| 80 | Acetylation | KKYIPGTKMIFAGIK HHCCCCCCEEEEEEC | 35.59 | 23923765 | |
| 88 | Acetylation | MIFAGIKKKGERADL EEEEEECCCCCHHHH | 65.18 | 22902405 | |
| 89 | Acetylation | IFAGIKKKGERADLI EEEEECCCCCHHHHH | 62.09 | 22902405 | |
| 98 | Phosphorylation | ERADLIAYLKKATNE CHHHHHHHHHHHHCC | 16.44 | 23991683 | |
| 100 | Acetylation | ADLIAYLKKATNE-- HHHHHHHHHHHCC-- | 27.90 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYC_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYC_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYC_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CYC_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Primary structure of mouse, rat, and guinea pig cytochrome c."; Carlson S.S., Mross G.A., Wilson A.C., Mead R.T., Wolin L.D.,Bowers S.F., Foley N.T., Muijsers A.O., Margoliash E.; Biochemistry 16:1437-1442(1977). Cited for: PROTEIN SEQUENCE OF 2-105, AND ACETYLATION AT GLY-2. | |