UniProt ID | CYC_BOVIN | |
---|---|---|
UniProt AC | P62894 | |
Protein Name | Cytochrome c | |
Gene Name | CYCS | |
Organism | Bos taurus (Bovine). | |
Sequence Length | 105 | |
Subcellular Localization | Mitochondrion intermembrane space. Loosely associated with the inner membrane. | |
Protein Description | Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.; Plays a role in apoptosis. Suppression of the anti-apoptotic members or activation of the pro-apoptotic members of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases (By similarity).. | |
Protein Sequence | MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MGDVEKGKK ------CCCHHHCCE | 47.90 | 5933874 | |
6 | Acetylation | --MGDVEKGKKIFVQ --CCCHHHCCEEEEE | 75.72 | 3937105 | |
8 | Acetylation | MGDVEKGKKIFVQKC CCCHHHCCEEEEEEC | 54.48 | 3937113 | |
9 | Acetylation | GDVEKGKKIFVQKCA CCHHHCCEEEEEECC | 50.47 | 127017 | |
14 | Acetylation | GKKIFVQKCAQCHTV CCEEEEEECCCCCEE | 26.66 | 3937117 | |
23 | Acetylation | AQCHTVEKGGKHKTG CCCCEECCCCCCCCC | 69.49 | 3937103 | |
26 | Acetylation | HTVEKGGKHKTGPNL CEECCCCCCCCCCCC | 51.07 | 3937119 | |
28 | Acetylation | VEKGGKHKTGPNLHG ECCCCCCCCCCCCCH | 59.67 | 2374837 | |
40 | Acetylation | LHGLFGRKTGQAPGF CCHHCCCCCCCCCCC | 58.34 | 3937109 | |
48 | Phosphorylation | TGQAPGFSYTDANKN CCCCCCCCCCCCCCC | 32.79 | 29541418 | |
49 | Phosphorylation | GQAPGFSYTDANKNK CCCCCCCCCCCCCCC | 13.33 | 16866357 | |
54 | Acetylation | FSYTDANKNKGITWG CCCCCCCCCCCCCCC | 62.85 | 3937115 | |
56 | Succinylation | YTDANKNKGITWGEE CCCCCCCCCCCCCHH | 53.98 | - | |
56 | Succinylation | YTDANKNKGITWGEE CCCCCCCCCCCCCHH | 53.98 | - | |
56 | Acetylation | YTDANKNKGITWGEE CCCCCCCCCCCCCHH | 53.98 | 3937121 | |
73 | Acetylation | MEYLENPKKYIPGTK HHHHHCHHHCCCCCC | 70.55 | 165127 | |
73 | Succinylation | MEYLENPKKYIPGTK HHHHHCHHHCCCCCC | 70.55 | - | |
73 | Succinylation | MEYLENPKKYIPGTK HHHHHCHHHCCCCCC | 70.55 | - | |
74 | Acetylation | EYLENPKKYIPGTKM HHHHCHHHCCCCCCE | 50.06 | 2374841 | |
80 | Acetylation | KKYIPGTKMIFAGIK HHCCCCCCEEEEEEC | 35.59 | 3937107 | |
87 | Acetylation | KMIFAGIKKKGERED CEEEEEECCCCCHHH | 47.73 | 2374845 | |
88 | Acetylation | MIFAGIKKKGEREDL EEEEEECCCCCHHHH | 65.18 | 3937111 | |
89 | Acetylation | IFAGIKKKGEREDLI EEEEECCCCCHHHHH | 62.09 | 3937123 | |
98 | Phosphorylation | EREDLIAYLKKATNE CHHHHHHHHHHHHCC | 16.44 | 18471988 | |
100 | Acetylation | EDLIAYLKKATNE-- HHHHHHHHHHHCC-- | 27.90 | 2381201 | |
101 | Acetylation | DLIAYLKKATNE--- HHHHHHHHHHCC--- | 58.82 | 3937097 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
29 | T | Phosphorylation | Kinase | PRKAA1 | Q13131 | GPS |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYC_BOVIN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYC_BOVIN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CYC_BOVIN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"The amino acid sequence of bovine heart cytochrome c."; Nakashima T., Higa H., Matsubara H., Benson A.M., Yasunobu K.T.; J. Biol. Chem. 241:1166-1177(1966). Cited for: PROTEIN SEQUENCE OF 2-105, AND ACETYLATION AT GLY-2. | |
Phosphorylation | |
Reference | PubMed |
"Mammalian liver cytochrome c is tyrosine-48 phosphorylated in vivo,inhibiting mitochondrial respiration."; Yu H., Lee I., Salomon A.R., Yu K., Huttemann M.; Biochim. Biophys. Acta 1777:1066-1071(2008). Cited for: PHOSPHORYLATION AT TYR-98. | |
"New prospects for an old enzyme: mammalian cytochrome c is tyrosine-phosphorylated in vivo."; Lee I., Salomon A.R., Yu K., Doan J.W., Grossman L.I., Huttemann M.; Biochemistry 45:9121-9128(2006). Cited for: PHOSPHORYLATION AT TYR-49. |