UniProt ID | CYB5D_ARATH | |
---|---|---|
UniProt AC | Q9ZWT2 | |
Protein Name | Cytochrome B5 isoform D {ECO:0000303|PubMed:19054355} | |
Gene Name | CYTB5-D {ECO:0000305} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 140 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein . |
|
Protein Description | Membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases, including fatty acid desaturases.. | |
Protein Sequence | MGGDGKVFTLSEVSQHSSAKDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDFEDVGHSSTAKAMLDEYYVGDIDTATVPVKAKFVPPTSTKAVATQDKSSDFVIKLLQFLVPLLILGLAFGIRYYTKTKAPSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | DGKVFTLSEVSQHSS CCCEEEHHHHCCCCC | 25561503 | ||
65 | Phosphorylation | DFEDVGHSSTAKAML CHHHCCCHHHHHHHH | 30407730 | ||
66 | Phosphorylation | FEDVGHSSTAKAMLD HHHCCCHHHHHHHHC | 30407730 | ||
67 | Phosphorylation | EDVGHSSTAKAMLDE HHCCCHHHHHHHHCE | 30407730 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYB5D_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYB5D_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYB5D_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CYB5D_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...