dbPTM

CY24A_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CY24A_MOUSE
UniProt AC	Q61462
Protein Name	Cytochrome b-245 light chain
Gene Name	Cyba {ECO:0000312\|MGI:MGI:1316658}
Organism	Mus musculus (Mouse).
Sequence Length	192
Subcellular Localization	Cell membrane.
Protein Description	Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. Associates with NOX3 to form a functional NADPH oxidase constitutively generating superoxide..
Protein Sequence	MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIAAGVLICLLEYPRGKRKKGSTMERCGQKYLTSVVKLFGPLTRNYYVRAALHFLLSVPAGFLLATILGTVCLAIASVIYLLAAIRGEQWTPIEPKPKERPQVGGTIKQPPTNPPPRPPAEVRKKPSEGEEEAASAGGPQVNPMPVTDEVV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
139	Ubiquitination	TPIEPKPKERPQVGG CCCCCCCCCCCCCCC	72.91	-
147	Phosphorylation	ERPQVGGTIKQPPTN CCCCCCCCCCCCCCC	21.05	26824392
149	Ubiquitination	PQVGGTIKQPPTNPP CCCCCCCCCCCCCCC	57.50	26194095
153	Phosphorylation	GTIKQPPTNPPPRPP CCCCCCCCCCCCCCC	68.02	23140645
168	Phosphorylation	AEVRKKPSEGEEEAA HHHCCCCCCCHHHHH	68.09	25521595
176	Phosphorylation	EGEEEAASAGGPQVN CCHHHHHHCCCCCCC	34.20	27742792
188	Phosphorylation	QVNPMPVTDEVV--- CCCCCCCCCCCC---	22.14	25367039

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CY24A_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Reference
147	T	Oxidation	-
Phosphorylation at Thr-147 enhances NADPH oxidase activity by promoting p47phox binding.
147	T	Phosphorylation	-
Phosphorylation at Thr-147 enhances NADPH oxidase activity by promoting p47phox binding.
149	K	ubiquitylation	26194095
Ubiquitinated at Lys-149 likely by RNF145.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CY24A_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of CY24A_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CY24A_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"The phagosomal proteome in interferon-gamma-activated macrophages."; Trost M., English L., Lemieux S., Courcelles M., Desjardins M.,Thibault P.; Immunity 30:143-154(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-168 AND SER-176, ANDMASS SPECTROMETRY.	19144319 [Abstract]
"Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry."; Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.; J. Proteome Res. 7:5314-5326(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-147, AND MASSSPECTROMETRY.	19367708 [Abstract]