dbPTM

CY1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CY1_SCHPO
UniProt AC	O59680
Protein Name	Cytochrome c1, heme protein, mitochondrial
Gene Name	cyt1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	307
Subcellular Localization	Mitochondrion inner membrane Single-pass membrane protein Intermembrane side .
Protein Description	Heme-containing component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain that generates an electrochemical potential coupled to ATP synthesis. The complex couples electron transfer from ubiquinol to cytochrome c (By similarity)..
Protein Sequence	MFQFVKKKNEFLKFARLGSRAFTQNAQKTHSKGSNIALVSSSLLSVGMIALYYNVYGPSLSAGTPKEEGLHFIQHDWPQSKVLSGFDHASLRRGFQVYREVCSACHSLNLIAWRHLVGVTHTADEAKQMASEVEYEDGPDDEGNMFKRPGKLSDFLPPPYPNVEAARASNNGAAPPDLSCVVRGRHGGQDYIYSLLTGYTEPPAGVEVPDGMNFNPFFPGTQIAMARPLFDDAVEFEDGTPATTAQAAKDVVNFLHWASEPELDIRKKMGFQVITVLTILTALSMWYKRFKWTPIKNRKIFYQRPIK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of CY1_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CY1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CY1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CY1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of CY1_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CY1_SCHPO

Related Literatures of Post-Translational Modification