| UniProt ID | CY1_MOUSE | |
|---|---|---|
| UniProt AC | Q9D0M3 | |
| Protein Name | Cytochrome c1, heme protein, mitochondrial | |
| Gene Name | Cyc1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 325 | |
| Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein Intermembrane side. |
|
| Protein Description | This is the heme-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain.. | |
| Protein Sequence | MAAAAASLRRTVLGPRGVGLPGASAPGLLGGARSRQLPLRTPQAVSLSSKSGPSRGRKVMLSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEEEAKALAEEVEVQDGPNDDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYTEVLEYDDGTPATMSQVAKDVATFLRWASEPEHDHRKRMGLKMLLMMGLLLPLTYAMKRHKWSVLKSRKLAYRPPK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 103 | Phosphorylation | WSHRGLLSSLDHTSI CCCCCHHHHCCCHHH | 33.62 | - | |
| 139 | S-nitrosocysteine | YRHLVGVCYTEEEAK HHHHHCEECCHHHHH | 2.60 | - | |
| 139 | S-nitrosylation | YRHLVGVCYTEEEAK HHHHHCEECCHHHHH | 2.60 | 22588120 | |
| 174 | Phosphorylation | RPGKLSDYFPKPYPN CCCCHHHCCCCCCCC | 20.57 | 25195567 | |
| 177 | Ubiquitination | KLSDYFPKPYPNPEA CHHHCCCCCCCCHHH | 47.48 | 22790023 | |
| 177 | Acetylation | KLSDYFPKPYPNPEA CHHHCCCCCCCCHHH | 47.48 | 23864654 | |
| 179 | Phosphorylation | SDYFPKPYPNPEAAR HHCCCCCCCCHHHHH | 23.05 | 25195567 | |
| 219 | S-palmitoylation | FSLLTGYCEPPTGVS EEEEECCCCCCCCCC | 7.19 | 28526873 | |
| 219 | S-nitrosylation | FSLLTGYCEPPTGVS EEEEECCCCCCCCCC | 7.19 | 21278135 | |
| 219 | S-nitrosocysteine | FSLLTGYCEPPTGVS EEEEECCCCCCCCCC | 7.19 | - | |
| 226 | Phosphorylation | CEPPTGVSLREGLYF CCCCCCCCCCCCCCC | 24.05 | 29899451 | |
| 307 | Acetylation | LPLTYAMKRHKWSVL HHHHHHHHHHCHHHH | 43.08 | 12433375 | |
| 310 | Acetylation | TYAMKRHKWSVLKSR HHHHHHHCHHHHHHC | 45.24 | 23864654 | |
| 315 | Ubiquitination | RHKWSVLKSRKLAYR HHCHHHHHHCCCCCC | 46.16 | 27667366 | |
| 315 | Acetylation | RHKWSVLKSRKLAYR HHCHHHHHHCCCCCC | 46.16 | 22902405 | |
| 318 | Acetylation | WSVLKSRKLAYRPPK HHHHHHCCCCCCCCC | 44.56 | 24062335 | |
| 325 | Acetylation | KLAYRPPK------- CCCCCCCC------- | 75.54 | 23864654 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CY1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CY1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CY1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CY1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
