| UniProt ID | CXB2_MOUSE | |
|---|---|---|
| UniProt AC | Q00977 | |
| Protein Name | Gap junction beta-2 protein | |
| Gene Name | Gjb2 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 226 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein. Cell junction, gap junction. |
|
| Protein Description | One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.. | |
| Protein Sequence | MDWGTLQSILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGCKNVCYDHHFPISHIRLWALQLIMVSTPALLVAMHVAYRRHEKKRKFMKGEIKNEFKDIEEIKTQKVRIEGSLWWTYTTSIFFRVIFEAVFMYVFYIMYNGFFMQRLVKCNAWPCPNTVDCFISRPTEKTVFTVFMISVSGICILLNITELCYLFVRYCSGKSKRPV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MDWGTLQSILGG ---CCHHHHHHHHCC | 19.85 | 26643407 | |
| 8 | Phosphorylation | MDWGTLQSILGGVNK CCHHHHHHHHCCCCC | 23.93 | 26643407 | |
| 112 | Ubiquitination | KFMKGEIKNEFKDIE HHHCCCCCHHCCCHH | 46.23 | 22790023 | |
| 116 | Ubiquitination | GEIKNEFKDIEEIKT CCCCHHCCCHHHHHC | 52.17 | 22790023 | |
| 122 | Ubiquitination | FKDIEEIKTQKVRIE CCCHHHHHCCEEEEE | 48.46 | 22790023 | |
| 125 | Acetylation | IEEIKTQKVRIEGSL HHHHHCCEEEEECEE | 38.42 | 8276427 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CXB2_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CXB2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CXB2_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CXB2_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
