| UniProt ID | CXA4_HUMAN | |
|---|---|---|
| UniProt AC | P35212 | |
| Protein Name | Gap junction alpha-4 protein | |
| Gene Name | GJA4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 333 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein. Cell junction, gap junction. |
|
| Protein Description | One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.. | |
| Protein Sequence | MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 77 | Phosphorylation | FPISHIRYWVLQFLF CCHHHHHHHHHHHHH | 10.16 | 24043423 | |
| 86 | Phosphorylation | VLQFLFVSTPTLVYL HHHHHHCCCCHHHHH | 22.72 | 24043423 | |
| 87 | Phosphorylation | LQFLFVSTPTLVYLG HHHHHCCCCHHHHHH | 18.26 | 24043423 | |
| 89 | Phosphorylation | FLFVSTPTLVYLGHV HHHCCCCHHHHHHHH | 29.01 | 24043423 | |
| 92 | Phosphorylation | VSTPTLVYLGHVIYL CCCCHHHHHHHHHHH | 15.30 | 24043423 | |
| 98 | Phosphorylation | VYLGHVIYLSRREER HHHHHHHHHHHHHHH | 9.49 | 24043423 | |
| 100 | Phosphorylation | LGHVIYLSRREERLR HHHHHHHHHHHHHHH | 16.60 | 24043423 | |
| 119 | Ubiquitination | ELRALPAKDPQVERA CCCCCCCCCHHHHHH | 68.92 | 30230243 | |
| 136 | Acetylation | AVERQMAKISVAEDG HHHHHHHCEEECCCC | 30.12 | 7710331 | |
| 155 | Phosphorylation | RGALMGTYVASVLCK HHHHHHHHHHHHHHH | 6.57 | 24719451 | |
| 158 | Phosphorylation | LMGTYVASVLCKSVL HHHHHHHHHHHHHHH | 12.94 | 24719451 | |
| 171 | Phosphorylation | VLEAGFLYGQWRLYG HHHHCCEECEEEECC | 12.66 | 24719451 | |
| 319 | Phosphorylation | PPQNGQKPPSRPSSS CCCCCCCCCCCCCCC | 24.98 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CXA4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CXA4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CXA4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CXA4_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
