UniProt ID | CXA4_HUMAN | |
---|---|---|
UniProt AC | P35212 | |
Protein Name | Gap junction alpha-4 protein | |
Gene Name | GJA4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 333 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. Cell junction, gap junction. |
|
Protein Description | One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.. | |
Protein Sequence | MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
77 | Phosphorylation | FPISHIRYWVLQFLF CCHHHHHHHHHHHHH | 10.16 | 24043423 | |
86 | Phosphorylation | VLQFLFVSTPTLVYL HHHHHHCCCCHHHHH | 22.72 | 24043423 | |
87 | Phosphorylation | LQFLFVSTPTLVYLG HHHHHCCCCHHHHHH | 18.26 | 24043423 | |
89 | Phosphorylation | FLFVSTPTLVYLGHV HHHCCCCHHHHHHHH | 29.01 | 24043423 | |
92 | Phosphorylation | VSTPTLVYLGHVIYL CCCCHHHHHHHHHHH | 15.30 | 24043423 | |
98 | Phosphorylation | VYLGHVIYLSRREER HHHHHHHHHHHHHHH | 9.49 | 24043423 | |
100 | Phosphorylation | LGHVIYLSRREERLR HHHHHHHHHHHHHHH | 16.60 | 24043423 | |
119 | Ubiquitination | ELRALPAKDPQVERA CCCCCCCCCHHHHHH | 68.92 | 30230243 | |
136 | Acetylation | AVERQMAKISVAEDG HHHHHHHCEEECCCC | 30.12 | 7710331 | |
155 | Phosphorylation | RGALMGTYVASVLCK HHHHHHHHHHHHHHH | 6.57 | 24719451 | |
158 | Phosphorylation | LMGTYVASVLCKSVL HHHHHHHHHHHHHHH | 12.94 | 24719451 | |
171 | Phosphorylation | VLEAGFLYGQWRLYG HHHHCCEECEEEECC | 12.66 | 24719451 | |
319 | Phosphorylation | PPQNGQKPPSRPSSS CCCCCCCCCCCCCCC | 24.98 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CXA4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CXA4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CXA4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CXA4_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...