UniProt ID | CX6B1_MOUSE | |
---|---|---|
UniProt AC | P56391 | |
Protein Name | Cytochrome c oxidase subunit 6B1 | |
Gene Name | Cox6b1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 86 | |
Subcellular Localization | Mitochondrion intermembrane space. | |
Protein Description | Connects the two COX monomers into the physiological dimeric form.. | |
Protein Sequence | MAEDIKTKIKNYKTAPFDSRFPNQNQTKNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPVSWVSAWDDRIAEGTFPGKI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAEDIKTKI ------CHHHHHHHH | 24.14 | - | |
6 | Malonylation | --MAEDIKTKIKNYK --CHHHHHHHHHHCC | 56.97 | 26073543 | |
13 | Ubiquitination | KTKIKNYKTAPFDSR HHHHHHCCCCCCCCC | 47.83 | 27667366 | |
13 | Succinylation | KTKIKNYKTAPFDSR HHHHHHCCCCCCCCC | 47.83 | 23954790 | |
28 | Acetylation | FPNQNQTKNCWQNYL CCCCHHCCCCHHHHH | 40.10 | 24062335 | |
30 | S-palmitoylation | NQNQTKNCWQNYLDF CCHHCCCCHHHHHHH | 4.16 | 28526873 | |
30 | Glutathionylation | NQNQTKNCWQNYLDF CCHHCCCCHHHHHHH | 4.16 | 24333276 | |
30 | S-nitrosylation | NQNQTKNCWQNYLDF CCHHCCCCHHHHHHH | 4.16 | 22588120 | |
42 | Acetylation | LDFHRCEKAMTAKGG HHHHHCHHHHHCCCC | 47.27 | 23201123 | |
47 | Malonylation | CEKAMTAKGGDVSVC CHHHHHCCCCCCHHH | 55.02 | 26320211 | |
47 | Succinylation | CEKAMTAKGGDVSVC CHHHHHCCCCCCHHH | 55.02 | 26388266 | |
52 | Phosphorylation | TAKGGDVSVCEWYRR HCCCCCCHHHHHHHH | 26.28 | 23737553 | |
54 | S-palmitoylation | KGGDVSVCEWYRRVY CCCCCHHHHHHHHHH | 2.06 | 28526873 | |
54 | S-nitrosylation | KGGDVSVCEWYRRVY CCCCCHHHHHHHHHH | 2.06 | 22588120 | |
62 | Acetylation | EWYRRVYKSLCPVSW HHHHHHHHHHCCCHH | 33.81 | 23576753 | |
65 | S-palmitoylation | RRVYKSLCPVSWVSA HHHHHHHCCCHHHCC | 3.95 | 28526873 | |
65 | S-nitrosocysteine | RRVYKSLCPVSWVSA HHHHHHHCCCHHHCC | 3.95 | - | |
65 | S-nitrosylation | RRVYKSLCPVSWVSA HHHHHHHCCCHHHCC | 3.95 | 22588120 | |
65 | Glutathionylation | RRVYKSLCPVSWVSA HHHHHHHCCCHHHCC | 3.95 | 24333276 | |
71 | Phosphorylation | LCPVSWVSAWDDRIA HCCCHHHCCCCCHHH | 19.86 | 22817900 | |
85 | Succinylation | AEGTFPGKI------ HCCCCCCCC------ | 45.54 | 23954790 | |
85 | Acetylation | AEGTFPGKI------ HCCCCCCCC------ | 45.54 | 23864654 | |
85 | Ubiquitination | AEGTFPGKI------ HCCCCCCCC------ | 45.54 | 27667366 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CX6B1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CX6B1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CX6B1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CX6B1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...